KEGG   Clostridium kluyveri NBRC 12016: CKR_0836Help
Entry
CKR_0836          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKR_0836
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CKR_0836
Enzymes [BR:ckr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CKR_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925226..926032
Genome map
AA seq 268 aa AA seqDB search
MKSRIVVKVGTSTLTSENGKIDLRNIEHLVRVLSDIMAKGVEVVLVTSAAITVGYEKMGL
PARPKELNLTQAAAAVGQCELMHIYDKLFNEYGRVAAQILLDEEDMCCEKRRQNLLRTFL
TLLEHGIIPIVNENDSVSYQEIESADKLFGDNDTLSAHVALLCGADKLILLSDIDGFYEQ
DPRENQNAELIQQVSCIDEHIKKLAGGSGTARGTGGMITKIHAAELVTPYGCEMFIVNGA
YPNYIYSILEGVSVGTYFKTTKEIQTIK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccagaattgtagttaaagttggaacttcgacattaaccagtgaaaatggaaaa
atagatttacgtaacattgagcatttggttcgggttttatcagacatcatggcaaaagga
gttgaagtcgtacttgtcacttcggcagctattacagtaggctatgaaaaaatggggctt
cccgcccgcccgaaagaattaaatttgactcaagctgccgccgctgttggccaatgtgag
ttaatgcatatctatgataagctgttcaacgaatatggcagggttgctgctcaaatctta
ttggacgaggaagatatgtgctgtgaaaaacggcgtcaaaacttgctccgtactttttta
actttgttggagcatggtattataccgattgtcaatgaaaacgattctgttagctatcaa
gaaatcgaatcggctgacaagctgtttggagataatgatacgttatcggctcatgttgca
cttttatgcggtgctgataaattgattttgctttcggatattgatgggttctatgagcaa
gatccgagagaaaatcagaacgcagagttaatccaacaggtatcatgtatcgacgaacac
attaaaaaattggcaggaggaagtggaaccgcaaggggtactggtggcatgattactaaa
attcatgcagcagaattggtgacaccttatggctgcgaaatgttcattgtcaacggtgct
tatcccaattatatttattctattttagagggggtctctgtgggaacctattttaagaca
acgaaagaaatacagacaataaaatag

DBGET integrated database retrieval system