KEGG   Clostridium kluyveri NBRC 12016: CKR_0865Help
Entry
CKR_0865          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKR_0865
Enzymes [BR:ckr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CKR_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960802..961617
Genome map
AA seq 271 aa AA seqDB search
MSRIMRIGEKDFQIGKRTYIMGILNITPDSFSDGGKFNNIELALERAKQMEIEGADIIDI
GGESTRPGYKPITEQEELERIIPVIGTLVKHINIPISVDTYRSKVAERALDVGASFVNDI
WGLKKDPRMAFIASHYKVPCCLMHNRDNTNYNNLIEDILNDLKESINIALNAGVDDKNII
LDPGIGFGKNYEQNLMVMRNLERFSELGYPVLLGTSRKSIIGNTLKLKVHERLEGTIATT
VIGIMKKCAFVRVHDVKENKRAAVMSDIIVR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaataatgaggataggtgaaaaagattttcaaataggtaaaagaacttatata
atgggtatacttaatattaccccagattctttttcagatggaggaaagtttaataatata
gaattagctttagaacgtgctaaacaaatggaaatagaaggagctgacataatagatata
ggtggagaatctacgagaccgggttataagcctataactgaacaggaagaactagagagg
attattcctgtaatagggacattagtaaaacacataaatatacctatttcggtagataca
tatagatctaaagttgcagaacgagctttagatgtaggagcatcttttgtaaatgatata
tggggacttaaaaaagatcctcgcatggcgtttatcgcatctcattataaggttccgtgt
tgtttaatgcataatagagacaatacaaactataataatttgatagaagatatattgaat
gatttaaaagagagtataaatattgctttaaatgctggagtagatgataaaaatataata
ttagatcctggaattggatttgggaagaactatgaacagaatttaatggttatgcgtaat
ttagaaaggttttctgaactaggttatcctgtgcttcttggaacctcaagaaaatcaatt
ataggaaatacattaaagcttaaagtacatgagcgattggaaggaactatagctaccaca
gtgataggtataatgaaaaaatgtgcttttgtaagagttcatgatgttaaagaaaataaa
agagcagctgtaatgtcagatataatagttagatga

DBGET integrated database retrieval system