KEGG   Clostridium kluyveri NBRC 12016: CKR_0866Help
Entry
CKR_0866          CDS       T00832                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961712..962269
Genome map
AA seq 185 aa AA seqDB search
MDENKIKDAVRMIIEAIGENPEREGLAETPDRIARMYTEIFSGLKEKPEEHLKKVFTVNN
DDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIPNGKVVGLSKLARTVEVFAKRLQLQERMT
VQIADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIFKNKIEFRNQVYE
MIKMK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaacaagattaaagatgctgtaagaatgattatagaagctataggagaaaat
cctgaaagagagggacttgcagaaacccctgataggattgccagaatgtatactgaaata
ttttccgggctaaaagaaaagccagaagaacatttaaagaaagtatttactgtaaataat
gatgatattgtgttagaaaaagacattcaattttattctatgtgtgaacaccattttatg
cctttttatggaaaaacacatgtagcatatatacccaatggtaaagttgttggattaagt
aagttggcaagaaccgtggaggtatttgcaaaaagacttcaacttcaagaaagaatgact
gttcaaattgcagattcaataatggattatctgaaagtaaaaggagttatggttgttata
gaagcagaacatatgtgtatgactatgagaggaataaaaaaaccaggaagtaaaactgtt
acagttgctaccagaggaatatttaaaaataaaattgaatttagaaatcaagtttatgaa
atgataaaaatgaaataa

DBGET integrated database retrieval system