KEGG   Clostridium kluyveri NBRC 12016: CKR_0928Help
Entry
CKR_0928          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKR_0928
Enzymes [BR:ckr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CKR_0928
Peptidases [BR:ckr01002]
 Cysteine Peptidases
  Family C44
   CKR_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042643..1044502
Genome map
AA seq 619 aa AA seqDB search
MEVTSLMCGIAGWINLKEDISKNRDIILNMTNTLKERGPDDQGYYFSKNVLLGHRRLIVV
DPSGGAQPMSKSVNGKKYIIVYNGELYNTEDLRKVFIKQNYSFNSYSDTEVLLTSYIHWG
VDCVKHINGIYAFAIWDEIENRLFMARDPLGVKPLFYTIRNNSLLFGSEIKTLLVHPYVE
PIVDKEGLTEIFALGPARSLGGGIFKDIHEVPPANYGIYTEDGFKLREYWKPECRIHNED
IETTAEHVRSLLVDAIKRQLVADVPICTFLSGGLDSSAISAVAASEFKKQGKILKTYSID
YEDNDKYFEANDFEPTPDRIWALKMSEYINSNHHGIINTSENLANALYNSVKASDLPGMA
DIDSSLYLFCREIRKDNTVALSGECADEIFGGYPWYRRPEDINAHTFPWSKSVGARKEIL
SHELKSLNLEEYLKEQYESSIRQVPHLEGESKLEHRMRELFYLNIKWFMITLLNRKDRMS
MSNSLEVRVPFADYRLVEYAFNIPSEIKFYKGREKGLLRKALKGILPEDIIERKKSPYPK
THNPEYTKRVQKWMKNIMKDKTSPILNLIDKKSVKTLIETGGASFKAPWFGQLMRGPQLL
AYLIQVNEWLKEYKVKIEI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
ttggaggtaacttctcttatgtgtggaattgcaggatggattaatctaaaagaggatatt
tctaaaaatagagatataattttaaatatgacaaatacgttaaaggaaagaggtcctgat
gatcagggatattatttttccaaaaatgtgctattaggccatagaagacttatagtggta
gatccttcaggcggcgctcagcctatgtccaaaagtgtaaatgggaaaaaatatataatt
gtatataatggggaactttataatactgaagatttaagaaaagtatttataaaacaaaat
tattctttcaactcatattcagatacggaagtactgctcactagttatatacattgggga
gtagattgtgtaaagcatataaatggtatatatgcttttgcaatttgggatgaaattgaa
aatagattatttatggcaagggatcctttgggagtaaaacctttattttatacaataaga
aataactctcttttattcggctcggaaattaaaacacttttagtacacccttatgtagaa
ccaatagtagataaggaaggattaactgaaatatttgctctggggcctgcaagatcttta
gggggaggtatattcaaggatatacatgaagtacctccagctaattatggaatatataca
gaagatgggtttaaattaagagaatactggaagcctgagtgcaggattcataatgaagat
atagaaactacagcggaacatgtaagaagtcttttggtagatgctataaaaaggcaactg
gtagcagatgttcccatttgcacattcctttcaggagggcttgattccagtgcaatatct
gcggtggcagcttcggaatttaaaaaacagggaaaaattttaaagacctattctattgac
tatgaagataatgataaatactttgaagcaaatgattttgaacctacccctgatagaatt
tgggccttaaaaatgtcagaatatataaatagcaatcatcatggaattataaatactagt
gaaaatttagccaatgcattgtataattctgtaaaggccagtgatcttccagggatggcg
gatatcgactcatctttatatcttttttgtagggaaattagaaaagataatactgtggct
ttatcaggggagtgcgcagatgaaatatttggtgggtacccatggtacagaaggccggaa
gatattaatgctcatacttttccatggtctaaatctgtaggtgctagaaaagaaattcta
tctcatgaattaaagtctctgaatctggaggaatatttaaaagaacaatatgaaagcagc
ataaggcaggttcctcacttagagggagaatcaaaattagaacatcgtatgagagaatta
ttttatttgaatattaaatggtttatgattactttattaaatagaaaagatagaatgagt
atgtcaaatagtctagaagtgagagttccttttgcagactatagattggtagaatatgct
tttaatataccttctgaaataaaattttataaaggcagagaaaaaggattattgagaaaa
gccttaaaaggaatattaccagaggatattattgagagaaaaaagagtccttatcctaaa
acccataatcctgaatatactaaaagggttcaaaaatggatgaaaaatataatgaaggat
aaaacatctcctattcttaatcttatagataaaaaatcagttaagactttaatagaaaca
ggaggagcttcttttaaagctccttggtttggacagcttatgagagggccacaattgctg
gcttatttaatacaggttaatgaatggcttaaggagtataaagttaaaatagaaatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system