KEGG   Clostridium kluyveri NBRC 12016: CKR_1082Help
Entry
CKR_1082          CDS       T00832                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CKR_1082 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKR_1082 (murE)
Enzymes [BR:ckr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CKR_1082 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1231411..1232868
Genome map
AA seq 485 aa AA seqDB search
MNLKDVLRGIDYKIIKGKNNLNIGEIQYDSRKVKTGDLFVCIAGYVTDGHKYIESAFKNG
AAAIVLSKKVDFIPDCTVIEVKDTRKALALMSSNYYDNPAEDMKIIGITGTNGKTTSTFM
VKSILETAGYKVGVVGTISNYIGNKKIPSHRTTPESLELQKLFKEMVDDGVDYCVMEASS
HSLYLDRVYGVEFCQALFTNLTRDHLDFHKTFEEYYKSKIILFKNTVNSVINIDDKYGER
VYEDAKGKKLTYAIDKNADLMADNLKIHSRGVNFNISYEGNTKHINLNIPGKYNVMNALG
SAGVCLAEGIDLNTVKKGLEDMPSVPGRCEIVTKSYNLGYEVVVDYAHTPDGLENILKCA
REFTKGKLISVFGCGGDRDSTKRPIMGNIGTKFSDFAVVTSDNPRGEEPMAIIKDILTGI
KKNNYIVIENRKEAIKKAMEMAETGDVVVIAGKGHEDYQILKDRTIHFDEREIVAEIIEE
STVNN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctaaaagatgtattgaggggaatagattacaaaattattaaaggaaaaaataat
ctaaatataggagaaattcaatatgattcaagaaaagttaaaactggagatttatttgtc
tgtattgcagggtacgttactgatggacacaagtatatagaaagtgcctttaaaaatgga
gcagcagcaattgtattaagcaagaaagttgatttcattcccgattgcactgtaatagaa
gtaaaagataccagaaaggcattggcactcatgtcatcaaattactatgataatcctgct
gaagatatgaaaataataggtataactggtaccaatggcaaaactacctccacatttatg
gtaaaatctatattggagactgcaggttataaagtgggagtggtaggtaccatatcaaat
tatataggaaataaaaagataccttcccataggactacacctgaatccttagaacttcag
aaattattcaaggaaatggtagatgatggtgtggattattgtgttatggaagcatcttct
cattccttatacctagatagggtatatggagtagagttttgtcaggctctattcacaaat
ttaaccagagatcatctggattttcataaaacctttgaagaatactataaatcaaaaatt
attctatttaaaaatacagttaattctgtaataaatatagatgataaatatggagaaagg
gtatatgaagatgccaagggtaaaaaattaacctatgctatagataaaaatgcagatttg
atggcggataatttaaaaattcattccagaggagtaaattttaatatatcatatgaaggg
aatacaaagcatataaatttaaatataccaggaaagtataatgtaatgaatgctcttgga
agtgcaggggtttgtctggcggaaggaatagatttaaatactgtaaaaaaaggattagaa
gatatgccttctgtgccaggtagatgtgaaatagtcacaaaatcatataatttgggatat
gaagttgtagtagactatgctcatactccagatggacttgaaaatatattaaaatgtgcc
agggaatttaccaaaggaaaacttatttctgtatttgggtgcggtggagatagggatagc
actaaaagacctataatgggaaacataggtacaaaattttctgattttgcagtagtgact
tctgataatcctaggggagaagagcctatggctataataaaggatatactaacaggtatt
aaaaaaaacaattacattgtaattgaaaatagaaaagaagccataaagaaggctatggaa
atggctgaaacaggagatgtagtagttatagcgggaaaaggccatgaagattatcagatt
ctaaaagatagaacaatacattttgatgaaagagaaatagtagcagaaatcatagaggaa
tccacagttaacaattaa

DBGET integrated database retrieval system