KEGG   Clostridium kluyveri NBRC 12016: CKR_1173Help
Entry
CKR_1173          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01130  Biosynthesis of antibiotics
ckr01230  Biosynthesis of amino acids
Module
ckr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKR_1173
Enzymes [BR:ckr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CKR_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAH06224
UniProt: B9E149
Position
1313246..1314034
Genome map
AA seq 262 aa AA seqDB search
MILDDIVGVKKKELEIRKESKPLKDIVDELSRIDEFKIRNFKGALINDDISIIGEIKRAS
PSKGIIDRKFEFEDICSTYETLDIDAVSVLTEQHYFKGKDEYLKKAKEFISKPVLRKDFI
VDEYQVYESKLLGADAVLLIVRILKENLDKFYKIASSIGLQCIVEVHNKSELDIALKIEP
EIIGINNRNLENFTVDLKNTENLINYMPENTAVISESGIKTSMDFKYIKSLPINGVLIGE
GLMKKIYDIESIKKFIDSVKSG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgatatagtaggtgtaaagaagaaggaactggagattagaaaggaaagt
aaacctctaaaagatattgtagatgaacttagcagaatagatgaatttaaaattagaaat
ttcaaaggtgccctgataaatgatgatatatctattataggggagataaaaagggcatct
ccctctaaaggtataatagaccgtaaatttgaatttgaagatatatgcagcacatatgaa
acgctggatatagatgctgtatctgtgcttactgagcagcattatttcaagggaaaagat
gaatatttaaagaaggctaaagagtttatttcaaaacctgtgctgagaaaagattttatt
gtagatgaatatcaagtttatgaatcaaagcttttaggggcagatgctgtacttctaata
gtaagaattttaaaagaaaacttagacaagttttataagatagcttcttccataggactt
caatgtattgtagaggtccataataaaagtgaactagatattgcccttaaaatagaaccg
gagataattggaataaacaataggaatcttgaaaattttactgtggatttaaaaaataca
gaaaatttaattaattatatgccagagaatactgctgtaatttcagaaagcgggataaaa
acaagtatggattttaaatatataaaaagtcttcctataaatggagtattaattggagaa
ggacttatgaaaaaaatttatgatatagagagtatcaaaaaattcatagatagtgtaaaa
agtggataa

DBGET integrated database retrieval system