KEGG   Clostridium kluyveri NBRC 12016: CKR_1175Help
Entry
CKR_1175          CDS       T00832                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKR_1175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKR_1175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKR_1175
Enzymes [BR:ckr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKR_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314662..1315852
Genome map
AA seq 396 aa AA seqDB search
MNKSYENSGRFGRFGGQYVPETVMTALMELEESFNKAKEDSKFIDEYMYYLQEYSGRPTP
LYYAENLTKNLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETGAGQHGV
AVATGAAMFQMECVIYMGEEDCRRQSLNVLRMKILGAKVVSVESGTKTLKDAVNEALRKW
VENIEDTFYVMGSVVGPHPYPTMVRDFQRIIGDETKEQILKKEGKLPNYIIACVGGGSNS
MGIFYPFVEDKSVKLIGVEAAGLGVDTDKHAASMAKGSVGVLHGMMTYLIQDDEGQILPV
YSVSAGLDYPGVGPEHAYLKDTKRAEYTYVTDQEALDAFGYLSRCEGIIPALESSHALAY
TMKLAPELSKEEIVVVNISGRGDKDVDTISELNIFG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaatcatatgaaaattcaggaagatttggaaggtttggaggacaatatgtaccg
gaaacagttatgactgcacttatggaacttgaagaaagttttaacaaagcaaaagaggat
agtaaatttattgatgaatacatgtactatttacaagagtattcaggaagacctacacca
ctttattatgcggaaaaccttactaaaaatttaggtggtgcaaagatatatttaaaaagg
gaagatttaaatcataccggtgcacataagataaataacgtattgggacagatacttctt
gcaaagagaatgggaaagaaaaaggtaatagcggaaaccggtgcaggacagcatggagtg
gcagtggctacaggggctgctatgtttcaaatggaatgtgtcatatatatgggagaagag
gactgcaggcggcaatctttaaatgtgcttagaatgaagatattaggggcaaaagtggtt
tctgtagagtcaggcactaaaactttaaaagatgcggtaaatgaagctcttagaaaatgg
gtagaaaatattgaagataccttttatgtaatgggttctgtagtggggcctcatccttat
ccaactatggtaagggattttcaaagaataataggagatgaaacaaaagagcagatttta
aaaaaagaaggaaaacttcccaattatataatagcatgtgtgggagggggaagtaactcc
atgggcattttttacccctttgtagaagataagagtgtaaaacttataggagttgaagca
gcaggacttggggtagacacagataaacatgcagcttctatggctaaaggctctgttgga
gtactccatggcatgatgacttatctcattcaagatgatgaaggacagatacttcctgtt
tattctgtatctgcaggacttgattatcccggagtaggacctgaacatgcctatttaaaa
gatacaaaaagggcggagtacacttatgttacagaccaggaagcactggatgcctttgga
tatttaagcaggtgtgaaggtataataccagctcttgaaagttctcatgcactggcttat
accatgaaattggcacctgaactttcaaaagaagaaatagttgtagtaaatatctcagga
cggggagacaaggacgtagatactatttcagaacttaatatatttggataa

DBGET integrated database retrieval system