KEGG   Clostridium kluyveri NBRC 12016: CKR_1176Help
Entry
CKR_1176          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00260  Glycine, serine and threonine metabolism
ckr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01130  Biosynthesis of antibiotics
ckr01230  Biosynthesis of amino acids
Module
ckr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKR_1176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKR_1176
Enzymes [BR:ckr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKR_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: BAH06227
UniProt: B9E152
Position
1315871..1316662
Genome map
AA seq 263 aa AA seqDB search
MNRIDFKFKELKDQGKKALIPFITAGDPSLDTTVNIVLEMDKKGADIVEIGIPYSDPLAD
GPIIQGSSQRAIKGGAKIRNIMETVRKIRGKSEIPLVYMVYYSSIFKYGLERFIAEASAV
GINGIIIPDLPIEERGDIMDITVKYEVHLIPLVAPTSKRRIQEIAAGGSGFVYCVSKNGV
TGVGEKIKTDIKEYMELVGSYTELPKALGFGISGSSMAREFKPYCDGIIIGSAIIDIIYK
CKGEKEILDKVGNFISEVKKSLE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattgattttaaatttaaagagttaaaagatcaaggtaaaaaagcacttata
ccttttataacagcaggagatcctagtctggatactacagttaatattgtgcttgaaatg
gataaaaaaggagcggatatagtggaaattggaataccctactccgatccactggcagat
gggcctattatacagggttcttctcaaagagcaataaaggggggagccaaaattagaaac
attatggaaactgtaagaaagataaggggaaaaagtgaaattcctcttgtatatatggta
tactacagttctatatttaaatatggtttggaaagatttatagcggaagcttctgctgta
ggaataaatggaattataatcccagatcttcccatagaagaaaggggagacataatggac
ataactgtaaaatatgaagttcacttaatacctcttgtggcacctacctcaaaaagaaga
attcaggaaatagcggctgggggatccggctttgtatattgcgtatctaaaaatggggta
actggagtgggagagaaaatcaaaactgatattaaagaatatatggaacttgtagggagc
tatacggaacttcctaaagctttgggctttggaatttcaggatccagtatggcaagagaa
tttaaaccttattgcgatggaataataatagggagtgccataattgacatcatatataaa
tgtaaaggggaaaaagaaatattagataaagtagggaattttatttcagaggtgaaaaag
agcttggagtag

DBGET integrated database retrieval system