KEGG   Clostridium kluyveri NBRC 12016: CKR_1176Help
Entry
CKR_1176          CDS       T00832                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKR_1176 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKR_1176 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKR_1176 (trpA)
Enzymes [BR:ckr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKR_1176 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315871..1316662
Genome map
AA seq 263 aa AA seqDB search
MNRIDFKFKELKDQGKKALIPFITAGDPSLDTTVNIVLEMDKKGADIVEIGIPYSDPLAD
GPIIQGSSQRAIKGGAKIRNIMETVRKIRGKSEIPLVYMVYYSSIFKYGLERFIAEASAV
GINGIIIPDLPIEERGDIMDITVKYEVHLIPLVAPTSKRRIQEIAAGGSGFVYCVSKNGV
TGVGEKIKTDIKEYMELVGSYTELPKALGFGISGSSMAREFKPYCDGIIIGSAIIDIIYK
CKGEKEILDKVGNFISEVKKSLE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattgattttaaatttaaagagttaaaagatcaaggtaaaaaagcacttata
ccttttataacagcaggagatcctagtctggatactacagttaatattgtgcttgaaatg
gataaaaaaggagcggatatagtggaaattggaataccctactccgatccactggcagat
gggcctattatacagggttcttctcaaagagcaataaaggggggagccaaaattagaaac
attatggaaactgtaagaaagataaggggaaaaagtgaaattcctcttgtatatatggta
tactacagttctatatttaaatatggtttggaaagatttatagcggaagcttctgctgta
ggaataaatggaattataatcccagatcttcccatagaagaaaggggagacataatggac
ataactgtaaaatatgaagttcacttaatacctcttgtggcacctacctcaaaaagaaga
attcaggaaatagcggctgggggatccggctttgtatattgcgtatctaaaaatggggta
actggagtgggagagaaaatcaaaactgatattaaagaatatatggaacttgtagggagc
tatacggaacttcctaaagctttgggctttggaatttcaggatccagtatggcaagagaa
tttaaaccttattgcgatggaataataatagggagtgccataattgacatcatatataaa
tgtaaaggggaaaaagaaatattagataaagtagggaattttatttcagaggtgaaaaag
agcttggagtag

DBGET integrated database retrieval system