KEGG   Clostridium kluyveri NBRC 12016: CKR_1191Help
Entry
CKR_1191          CDS       T00832                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ckr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ckr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332923..1334230
Genome map
AA seq 435 aa AA seqDB search
MKEEIISIIKANTQKGKEYFNDLRNKEEEAHNNVILEVNEILEQVKKKGDTSLIKYTNRF
DSCNVTKENMLVTQSETEDAYRLVEDEFIEALKTASENIMFFHQKQKRNSWITTREDGIM
LGQQIRPLERVGIYVPGGRAAYPSSVLMNTIPAKVAGVEEIIMVTPPMKDGTINPNILVA
ADIAGVDKIYKVGGAQAVGALAFGTESINKVDKIVGPGNVFVAMAKKSVYGYVDIDMIAG
PSEILIIADEGAKASYLAADLMSQAEHDLMASSILITTSKDLAKEVKKELEKQIEHLERK
DIIRKSLKDHGVIMLVESIEQALDISNKIAPEHLEVCIRDPFMVLGDIKNAGSIFLGDFS
PEPLGDYMAGPNHVLPTSGTARFFSPLSVDDFIKKSSFTHYSERALSKIGDKIVKLAQGE
GLTAHANSIMVRNKA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaaattataagtattataaaagcaaatacacaaaagggaaaagaatatttc
aatgaccttagaaataaagaggaagaagcacataacaatgtgattttagaagtaaatgaa
atacttgagcaagttaagaaaaaaggagacacctcacttataaaatatactaataggttt
gacagctgtaatgtgacaaaagagaatatgctggtaacccaaagcgaaacagaagatgct
tatagattagtagaagatgagtttatagaagcgttaaagacagcttctgaaaatataatg
ttttttcaccaaaaacagaaaagaaattcatggataactacaagggaagatggaataatg
cttggacagcaaataagacccttggaaagggtgggtatatatgtacctggaggtagggcg
gcatatccatcttccgtacttatgaatactattccggccaaggtagccggagtagaagaa
attattatggtgacacctcctatgaaagatggaactataaatcctaatattttggtggct
gcagatatagcaggagtagacaagatatataaagtgggaggagctcaggctgtgggcgca
ctggcttttggcactgagagtattaataaggtggataaaatagtgggtcctggaaatgta
tttgtagccatggctaaaaaaagtgtgtatggttatgtggatatagatatgatagcagga
cctagtgaaatattgataattgcagatgagggggcaaaggcatcctatctggcagcagac
ttaatgtcacaggcggaacacgatttaatggcttcctccatacttattaccacttctaaa
gatttagccaaagaggtgaaaaaagagcttgaaaaacagatagaacacttagaaagaaaa
gatataataagaaaatccttaaaagatcatggagttataatgttggtagaaagtatagaa
caggctttggatatatcaaataaaatagctccggaacatctggaggtttgcataagggat
ccttttatggtacttggggatataaaaaatgcaggttccatatttttaggggatttttca
ccagaacctttaggggattatatggcaggacctaaccacgtgctgcctaccagcggtact
gccagatttttttctcctttatctgtagatgattttataaaaaaatctagttttacacat
tattcagagagggcactttcaaaaataggagataaaattgtaaaattggcacaaggggaa
gggcttactgcacatgccaactccataatggtaagaaataaagcttaa

DBGET integrated database retrieval system