KEGG   Clostridium kluyveri NBRC 12016: CKR_1485Help
Entry
CKR_1485          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKR_1485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_1485
   00052 Galactose metabolism
    CKR_1485
   00500 Starch and sucrose metabolism
    CKR_1485
   00520 Amino sugar and nucleotide sugar metabolism
    CKR_1485
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CKR_1485
   00524 Butirosin and neomycin biosynthesis
    CKR_1485
Enzymes [BR:ckr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CKR_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672270..1673244)
Genome map
AA seq 324 aa AA seqDB search
MFGGRFSLEEKYVIGVDLGGTKIAAALVDFKGTIICKYTLPTKAEEGEKYILDNIIKIIE
KVVNFGGVCSKKIKCIGLGAPGPLDIDKGKIICTPNLPFKNFNIVSPLKNHFKMPIFLDN
DGNAAAIAEHMFGAGKGINNMVFITVSTGIGGGAILNGQIYRGNTKNALEIGHMTLDAQG
PLCNCGNFGCAEVMASGTAIAREAKKAVKMGYNTTLALYKNITSKEVFKEAQLGDSISQN
ILDTTLNYLGICVANIITCLDPEAVIIGGGVSKGGKIIFDKINEVVKRRCFGTVSKNTRI
LPALLGTDAGVIGAAALAFIEEKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggaggaagattcagtttggaagaaaaatatgtaataggagttgatttagggggc
actaaaatagctgctgctttagtggattttaaaggaacaataatatgtaaatataccttg
cctacaaaagcagaagaaggagaaaaatatatattagataatataataaaaatcatagaa
aaagtagtgaactttggcggagtttgcagtaaaaaaataaaatgtattggattaggagct
ccgggtcctcttgatatagacaaaggaaaaattatatgtactccaaacctgccctttaaa
aattttaatattgtaagccccttgaaaaatcattttaagatgcccatatttttagataat
gatggtaatgctgcggctatagccgaacacatgttcggtgcaggaaaaggaattaataat
atggtgtttataactgtttctacggggataggaggaggagcaatattaaatggacagata
tataggggtaataccaaaaatgctctggaaataggacatatgaccttagatgcacagggt
ccgctttgcaattgtggtaattttggatgcgcagaagtaatggcttcaggaacagctata
gctagagaagcaaaaaaagcagtaaagatgggatataataccacccttgcattatataaa
aatataacttcaaaagaggtctttaaagaagctcaattaggagatagtatatcacaaaat
atactagatacaactttaaattatttgggtatatgtgtagcgaatataattacttgttta
gatccggaagctgtgattataggtggaggagtctcaaaagggggaaaaatcatctttgat
aaaataaatgaagtagtgaaaaggagatgctttggtacagtaagtaaaaatacaaggata
cttcctgcacttttgggaacagatgcaggcgttataggagccgcagcacttgcatttata
gaagaaaaattttag

DBGET integrated database retrieval system