KEGG   Clostridium kluyveri NBRC 12016: CKR_1499Help
Entry
CKR_1499          CDS       T00832                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CKR_1499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_1499
   00620 Pyruvate metabolism
    CKR_1499
   00650 Butanoate metabolism
    CKR_1499
  Lipid metabolism
   00071 Fatty acid degradation
    CKR_1499
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKR_1499
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKR_1499
   00626 Naphthalene degradation
    CKR_1499
Enzymes [BR:ckr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKR_1499
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CKR_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688197..1690827
Genome map
AA seq 876 aa AA seqDB search
MKVTNVEELMKKLQKVRQAQEKFSTYTQEQVDEIFKQAAMAANSARIKLAKMAVEETGMG
IVEDKVIKNHFVSEYVYNKYKDEQTCGVLERDEGFGMVRIAEPVGVIAAVVPTTNPTSTA
IFKALIALKTRNGIVFSPHPRAKRSTVAAAKIVLDAAVEAGAPVEIIGWIDEPSIELSQL
VMKEADLILATGGPGMVRAAYSSGKPAIGVGPGNTPVIIDDSANIKMAVNSILLSKSFDH
GVICASEQSVMVLDRIYEEVKTEFSERGGYILKNDEIDKVRETILVNGSISPDIVGQSAR
KIAEMAGVKVPERTKILIGEVESVELEEPFSREKLSPVLAMYRVKNFNDGLKKAARLVEL
GGIGHTSVLYVNTMTQKEKVEKFSEAMKTGRTLINMPSAQGAIGDLYNFKLAPSLTLGCG
SWGGNSISENVGPKHLLNIKSIAERRENMLWFRVPEKIYFKYGALGTALKELKTMHKKKV
FIVTDKVLYQLGYTDSITKILGEMGVGYKIFTDVEPDPTLATAKKGSAEMLQYNPDTIIS
VGGGSAMDAAKIMWVMYEHPEIKFEDLAMRFMDIRKRVYTFPKMGEKSMMISVATSAGTG
SEVTPFTVITDEKTGAKYPLADYELTPDIAIIDAELMMNMPKGLTAASGIDAMTHALESY
VSVMASEYTNGLALEAIRLIFKYLPLAYAEGTTNVKAREKMAHASTMAGMAFANAFLGVC
HSMAHKLGAAHHIPHGIANALMIDEVIKFNAVNDPRKQAIFPQYKYPNAKWRYARIADYL
ELGGNSEDEKVGLLIKAIDELKEKINIPKTIREAGVAEKKFYATLDDMSEQAFDDQCTGA
NPRYPLISEIKQMYINAFDKVSPVVDEEEKLKVSLL
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacaaatgttgaggaattaatgaaaaaattacaaaaggtaagacaggcacag
gagaaattttccacttatacccaggaacaggtagatgagattttcaaacaggcagctatg
gcagccaatagtgccagaataaaacttgctaaaatggctgtggaagaaactggcatggga
attgtggaagataaggtcatcaaaaatcattttgtttcagaatatgtgtacaacaaatat
aaggatgaacagacctgcggggtcttagaaagagatgaaggctttggtatggttagaatt
gcagaacctgtaggtgttattgcagcagttgtgcccactacaaatcccacctctacagca
atattcaaagctctaatagctcttaaaacccgaaatggcatagttttttcacctcatcct
agagctaaaagatcaactgttgcggcagcaaaaatagtccttgatgctgcagttgaggca
ggggcaccggtggaaattataggatggatagatgaaccctcaattgaactttctcagtta
gtaatgaaggaggcggatttaattcttgctacaggcggaccaggaatggttagggcagct
tattcatcgggaaaacctgccataggagttggtcctggaaacacccctgttataattgat
gacagtgcaaatattaaaatggcagtaaactctatacttctttcaaaaagctttgatcat
ggtgtgatatgtgcctcggagcagtcagtaatggtactggatagaatatatgaggaagta
aaaacagaattttcagaaagagggggatatatactgaaaaatgatgaaatagataaggtc
agagagactattttagttaatggaagcataagtcctgatattgttggacagagtgctcgt
aaaatagcagagatggcaggagtgaaagtgcctgagagaacaaagatactcataggtgaa
gtagagtctgtagaacttgaagaaccattctctcgtgaaaaattatctccggttcttgcc
atgtacagagttaaaaatttcaatgatggtctgaaaaaagcagcaagactggttgaattg
ggaggcatagggcatacttctgtgctttatgtaaatactatgacccaaaaagaaaaagtg
gaaaagttcagtgaagctatgaagacaggcagaacccttataaatatgccatcagcacag
ggagctataggagatctatataattttaaactggctccttcattgacccttggctgcggt
tcctggggaggaaactccatatcagaaaatgtgggaccaaaacatttgttgaatataaag
agtattgcggagaggagagaaaacatgctttggtttagggttcctgaaaaaatttatttt
aaatacggtgcacttggaactgccctaaaagaactaaagactatgcataagaagaaggtc
ttcatagtaacagataaggttctttatcaattaggatatacagatagtattacaaaaatt
cttggagaaatgggagtaggctataaaatatttacagatgtggaacctgatccaaccctt
gctacagctaaaaaaggttcagcagaaatgcttcaatataatccagatactattatatca
gttggaggcggctccgcaatggacgctgcaaaaatcatgtgggttatgtacgaacatcct
gaaataaaatttgaagacctggccatgagatttatggatataagaaagagagtttataca
ttccctaagatgggcgaaaaatccatgatgatttcggtggccacatctgcaggaacggga
tcagaagttactccgtttacagtaattactgatgaaaaaacaggagccaaataccctctg
gcggattatgaattaacaccagatatagctataattgatgcagagcttatgatgaatatg
ccaaagggactaactgcagcatcgggtatagatgcaatgacccatgccctggagtcttat
gtatctgtaatggcttcagaatataccaatgggttggcacttgaagcaataagattgata
tttaagtatttaccgctagcttatgcggaaggaaccactaatgtaaaagccagagaaaaa
atggcacatgcttcaactatggcgggtatggcatttgccaatgcatttttaggagtatgc
cactccatggcccacaaattaggagctgcacaccatatacctcatggaattgccaatgca
cttatgatagatgaagttataaaatttaatgcagtaaatgatccaagaaaacaggcaata
tttcctcagtataaataccctaacgccaagtggagatatgccagaatagctgattatctg
gagttaggtggaaatagtgaagatgaaaaagtagggcttttgataaaggcaatagatgaa
ttaaaagaaaaaataaatattccaaaaaccattagagaggcaggagttgcggagaaaaaa
ttttatgccaccctagatgatatgtcggaacaggcctttgatgatcagtgcacaggggca
aatccaagatatccactcataagtgaaataaaacagatgtatataaatgcctttgataaa
gtaagtcccgttgtagatgaggaagaaaaactaaaggtatctttgttatag

DBGET integrated database retrieval system