KEGG   Clostridium kluyveri NBRC 12016: CKR_1541Help
Entry
CKR_1541          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K02004  
putative ABC transport system permease protein
Organism
ckr  Clostridium kluyveri NBRC 12016
Module
Putative ABC transport system
Brite
Transporters [BR:ckr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    CKR_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1740886..1742208)
Genome map
AA seq 440 aa AA seqDB search
MKFSDCLKMAFSDLGRRKIRTVLTSFGIAIGAMLVVLMSGFGQGIQKIAMDQIKQMDTMR
IIQVKPEQNSSKNSKQNKSEFKKIDNTVLDKFKGMKNVEEVSASIDTQIQEVFINGKEIS
EVNVKGSNLELPIFLNSQQNEIKLDKKKSKKYGYKPIIAGEVIKQGDEDSVLLGQGLADK
AGIKDYKSIIGKNIEMRVYLPSIPGLPEKEPLIINAKVSGVVNKNYDNGKNVITASSKTA
AKIQQYYTEEENYMEEKGYNNISVEVNTTEGVEGVDSSIKKMGYVTNSQVESTKTLKTMM
TIIKALLTAAGIVVLLVASIGVINTMTMAVYEKTKSIGIMKAQGASRNNISRMFTVQAGS
LGFIGGLFGGITALVLGFVINRIVVVYNIGGIQPGMKIIDVNISVFVFTLLFTILVSVAA
GMVPARRASKLNPVDSLRNE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcagattgtttaaaaatggcattttcagatcttggcaggagaaaaattcgt
actgtacttacatcctttggtatagctataggggcaatgctggtggtgttaatgtcaggt
tttggacagggaattcaaaaaatagccatggatcaaataaaacagatggataccatgaga
ataattcaagtaaaacctgaacaaaatagcagtaaaaattcgaagcaaaataaaagtgaa
tttaaaaagatagacaatactgtacttgataaatttaagggtatgaagaatgtagaggag
gtcagtgcatctattgatacccagatacaggaggtttttataaatggaaaagaaatttcc
gaggtaaatgttaaaggaagcaatctggaacttcctatatttttaaactcacagcaaaat
gaaataaagttagataaaaagaagagcaaaaaatatggatataagcctattattgcaggg
gaggttataaaacagggagatgaggattctgtacttttaggtcaggggcttgcagataaa
gctggtataaaggactataaaagtattattggaaagaatatagaaatgagagtttatctg
ccctctattccaggacttcctgaaaaagagcctcttataataaatgcaaaagtttcaggg
gtggtaaataaaaattatgacaatggaaaaaatgtaataacagcttccagtaaaacagca
gcaaaaattcaacaatattatacagaagaagaaaattacatggaggaaaagggatataat
aatataagcgtggaagtaaataccacagagggcgtagagggtgtggacagcagtattaag
aaaatgggatatgttacaaattcacaagttgaaagcactaaaaccttaaaaaccatgatg
accataataaaggcacttttaactgccgcaggtatagtggtacttcttgtagcatctata
ggggtaataaataccatgaccatggcagtatatgaaaagacaaaatctataggcataatg
aaggcacagggtgcatcaagaaataatataagtagaatgtttacagttcaagctggaagt
ctaggatttataggaggtctttttggaggtataacagctcttgtattaggttttgttata
aacagaattgtggtagtgtataatataggaggcatacaacctggcatgaaaataatagat
gtgaatatttcagtttttgtatttactttgttatttactatactggtatctgtagcagca
ggtatggttccagctaggagagcttctaaactcaatcctgtggattcactgagaaatgaa
taa

DBGET integrated database retrieval system