KEGG   Clostridium kluyveri NBRC 12016: CKR_1541Help
Entry
CKR_1541          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K02004  
putative ABC transport system permease protein
Organism
ckr  Clostridium kluyveri NBRC 12016
Module
Putative ABC transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740886..1742208)
Genome map
AA seq 440 aa AA seqDB search
MKFSDCLKMAFSDLGRRKIRTVLTSFGIAIGAMLVVLMSGFGQGIQKIAMDQIKQMDTMR
IIQVKPEQNSSKNSKQNKSEFKKIDNTVLDKFKGMKNVEEVSASIDTQIQEVFINGKEIS
EVNVKGSNLELPIFLNSQQNEIKLDKKKSKKYGYKPIIAGEVIKQGDEDSVLLGQGLADK
AGIKDYKSIIGKNIEMRVYLPSIPGLPEKEPLIINAKVSGVVNKNYDNGKNVITASSKTA
AKIQQYYTEEENYMEEKGYNNISVEVNTTEGVEGVDSSIKKMGYVTNSQVESTKTLKTMM
TIIKALLTAAGIVVLLVASIGVINTMTMAVYEKTKSIGIMKAQGASRNNISRMFTVQAGS
LGFIGGLFGGITALVLGFVINRIVVVYNIGGIQPGMKIIDVNISVFVFTLLFTILVSVAA
GMVPARRASKLNPVDSLRNE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcagattgtttaaaaatggcattttcagatcttggcaggagaaaaattcgt
actgtacttacatcctttggtatagctataggggcaatgctggtggtgttaatgtcaggt
tttggacagggaattcaaaaaatagccatggatcaaataaaacagatggataccatgaga
ataattcaagtaaaacctgaacaaaatagcagtaaaaattcgaagcaaaataaaagtgaa
tttaaaaagatagacaatactgtacttgataaatttaagggtatgaagaatgtagaggag
gtcagtgcatctattgatacccagatacaggaggtttttataaatggaaaagaaatttcc
gaggtaaatgttaaaggaagcaatctggaacttcctatatttttaaactcacagcaaaat
gaaataaagttagataaaaagaagagcaaaaaatatggatataagcctattattgcaggg
gaggttataaaacagggagatgaggattctgtacttttaggtcaggggcttgcagataaa
gctggtataaaggactataaaagtattattggaaagaatatagaaatgagagtttatctg
ccctctattccaggacttcctgaaaaagagcctcttataataaatgcaaaagtttcaggg
gtggtaaataaaaattatgacaatggaaaaaatgtaataacagcttccagtaaaacagca
gcaaaaattcaacaatattatacagaagaagaaaattacatggaggaaaagggatataat
aatataagcgtggaagtaaataccacagagggcgtagagggtgtggacagcagtattaag
aaaatgggatatgttacaaattcacaagttgaaagcactaaaaccttaaaaaccatgatg
accataataaaggcacttttaactgccgcaggtatagtggtacttcttgtagcatctata
ggggtaataaataccatgaccatggcagtatatgaaaagacaaaatctataggcataatg
aaggcacagggtgcatcaagaaataatataagtagaatgtttacagttcaagctggaagt
ctaggatttataggaggtctttttggaggtataacagctcttgtattaggttttgttata
aacagaattgtggtagtgtataatataggaggcatacaacctggcatgaaaataatagat
gtgaatatttcagtttttgtatttactttgttatttactatactggtatctgtagcagca
ggtatggttccagctaggagagcttctaaactcaatcctgtggattcactgagaaatgaa
taa

DBGET integrated database retrieval system