KEGG   Clostridium kluyveri NBRC 12016: CKR_1870Help
Entry
CKR_1870          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ckr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ckr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2095561..2096676)
Genome map
AA seq 371 aa AA seqDB search
MKKIKVLVVDDSALMRKIISDMIKEDSSIEVIGTARNGQDLMDKFSSNFYKTMPDVITMD
VEMPKMDGITALGELKKKNIDIPVIILSSISKEGTKLTMECLAAGAFDFLPKPSGTISLD
IDKVKVELIQKIKVAYFGTSNQNSPIKTISAAENKSYKEIATVRISAENTKKARESKFQP
GRIDAVVMGASTGGPKALTSVITELPKDIGVPVFVVQHMPVGFTKAFAERLNLSSHVKVV
EAQEGMTAEINVVYIAPGGYHMEVWNDKKIHLNKEPAIWGVRPAVDKLFVSASKVYKENI
VSVVLTGMGKDGAEGTVEIKKNGGITISQDEATCTIYGMPKVAYETGKVDLVLPLNDIAK
EMLKIITSGRR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagattaaggttttagtagtagatgattcagcacttatgagaaaaattatctca
gacatgataaaagaggacagttccatagaagtaataggtactgccagaaatggacaggat
cttatggataaattttcttctaatttttataaaactatgccagatgtaataaccatggat
gtagagatgccaaaaatggatggcataactgcacttggagagcttaaaaagaaaaatata
gatatacctgtaataattttaagtagtatttcaaaagaaggtacaaagctcaccatggaa
tgtttagcagcaggagcctttgattttttacctaaaccctctggaaccatatcccttgat
atagataaagtaaaagttgaattgatacaaaaaattaaagtggcttattttggtacatcc
aatcaaaatagtcctattaaaaccataagtgcagctgaaaataaaagttataaagagatt
gccacagtgcgtatttcagctgaaaatactaaaaaagcaagagagagtaaatttcaacca
ggaagaatagatgctgtagtaatgggggcgtctacaggaggacctaaggcacttacttca
gttataacagaactgccaaaagatataggagtgcctgtatttgtggtacagcatatgcct
gtaggttttaccaaagcttttgcagagaggctgaatttaagttctcatgtaaaagtagta
gaagcacaagaaggaatgactgctgaaataaatgttgtatacatagctccaggcgggtat
catatggaagtatggaatgataaaaaaatacacctgaataaagaacctgcaatatgggga
gtgagacctgcggtggataaactatttgtatctgcctcaaaggtgtataaggaaaatata
gttagtgtagttttaacgggaatgggaaaagatggtgcagaaggaactgtggaaattaaa
aaaaatggaggtatcaccatatcgcaagatgaggctacctgtaccatttatggcatgcca
aaagttgcatatgaaacgggaaaagtagatttggttttaccgctaaatgatatagcaaaa
gaaatgttgaaaataataacatctggtaggaggtag

DBGET integrated database retrieval system