KEGG   Clostridium kluyveri NBRC 12016: CKR_1935Help
Entry
CKR_1935          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ckr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172017..2172499
Genome map
AA seq 160 aa AA seqDB search
MLSIIVALNENYAIGYNNKLIYHISGDLKRFKKITYGKTIIMGRKTFESLPNILLNRKHI
IITRNPNYNIKSENVFVVHNIKDVIKYEHSKEEYFIIGGGEIYAQLLPYCTKLYLTKIAS
EEKKGDTYFPKFNIHNYNIIEYEKHNENNIEYNFITLEKI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtataattgtagctcttaatgaaaattacgcaataggatataataataagctt
atatatcacatatctggagacttaaaaagattcaaaaaaatcacctatggtaaaacaatt
ataatgggacgaaagacattcgaatctcttccaaacatattattaaatagaaaacatatt
attattacaagaaatcctaactataacattaaatccgaaaatgtattcgtagtacacaat
attaaagatgtgataaaatatgaacactctaaggaagaatactttataataggaggaggg
gaaatctacgcccaattacttccttattgtaccaaattatatttaactaaaatagcttct
gaagaaaaaaaaggtgatacatatttccctaagtttaatatacataattataatataatt
gaatatgaaaaacacaatgaaaataatattgaatacaatttcataactcttgagaagatt
taa

DBGET integrated database retrieval system