KEGG   Clostridium kluyveri NBRC 12016: CKR_2123Help
Entry
CKR_2123          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00330  Arginine and proline metabolism
ckr01100  Metabolic pathways
Module
ckr_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CKR_2123
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CKR_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: BAH07174
UniProt: B9E3U9
Position
complement(2414035..2414982)
Genome map
AA seq 315 aa AA seqDB search
MSKNQLPDSSLLPRFCDMGNFMRLQKKENADGLDVGILGIPFDTASSFRTGSRFGPSSIR
KISTMIKPNNIIMGVNIVDILNIADLGDVPIVPGYIKESYDAIYKSVSEVLDAGAVPLCL
GGDHSITLGELRAVYKKHGKVSLIHFDSHLDLGKSVFGKYYTHGTPFRRALEEGLIDPST
SIQIGIRGSMYDLNDIKIAEDLGFEVITAHKLHKMTEEELGEKIKGRVGQGKAFLTFDID
FVDPAYAPGTGTPEVGGFTSHETLSYIQQLKDINFIGCDIVEVAPDYDCSEITAYLAASI
GFEFMSILACKKQCL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatcaattaccagactcttcactattacctagattttgtgatatgggcaat
tttatgagattacaaaaaaaagaaaatgcagatggattggatgtaggaattttaggaata
ccctttgatacagcatcttcatttcgcactggttccagatttggtccaagtagtattcgc
aagatctctactatgattaaacctaacaatataataatgggagtaaatattgtggatatt
ctaaatatagcagatttgggagatgttccaattgtccctggatatataaaagaaagttat
gatgctatttacaaaagcgtttctgaagttctagatgctggagctgtgcctttgtgttta
ggtggagatcattcaattactttaggtgaattacgtgctgtttataaaaaacatggaaaa
gtttctttaatacattttgactctcatttggatttgggtaaaagtgtatttggcaaatat
tatacccacggaacgccatttagaagggcattggaagaaggcttaattgacccttcaacc
tcaatccaaattggtatacgtggttctatgtatgatttaaatgatattaaaatagcagaa
gatttaggattcgaggtcattacagcacataaattacacaaaatgacagaagaagaatta
ggagagaaaattaaaggaagggtaggacagggaaaagcatttttaacatttgacattgat
tttgtagatccggcttatgcccctggtactggaactccagaagttggagggtttacatcc
catgaaacattgtcttatatacaacaactaaaagacattaattttataggatgtgacatt
gtagaggtggctccagattatgactgcagtgaaattactgcatatctggcggcaagtatt
ggctttgaattcatgtctatattggcatgtaaaaagcagtgcctatga

DBGET integrated database retrieval system