KEGG   Clostridium kluyveri NBRC 12016: CKR_2123Help
Entry
CKR_2123          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ckr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2414035..2414982)
Genome map
AA seq 315 aa AA seqDB search
MSKNQLPDSSLLPRFCDMGNFMRLQKKENADGLDVGILGIPFDTASSFRTGSRFGPSSIR
KISTMIKPNNIIMGVNIVDILNIADLGDVPIVPGYIKESYDAIYKSVSEVLDAGAVPLCL
GGDHSITLGELRAVYKKHGKVSLIHFDSHLDLGKSVFGKYYTHGTPFRRALEEGLIDPST
SIQIGIRGSMYDLNDIKIAEDLGFEVITAHKLHKMTEEELGEKIKGRVGQGKAFLTFDID
FVDPAYAPGTGTPEVGGFTSHETLSYIQQLKDINFIGCDIVEVAPDYDCSEITAYLAASI
GFEFMSILACKKQCL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatcaattaccagactcttcactattacctagattttgtgatatgggcaat
tttatgagattacaaaaaaaagaaaatgcagatggattggatgtaggaattttaggaata
ccctttgatacagcatcttcatttcgcactggttccagatttggtccaagtagtattcgc
aagatctctactatgattaaacctaacaatataataatgggagtaaatattgtggatatt
ctaaatatagcagatttgggagatgttccaattgtccctggatatataaaagaaagttat
gatgctatttacaaaagcgtttctgaagttctagatgctggagctgtgcctttgtgttta
ggtggagatcattcaattactttaggtgaattacgtgctgtttataaaaaacatggaaaa
gtttctttaatacattttgactctcatttggatttgggtaaaagtgtatttggcaaatat
tatacccacggaacgccatttagaagggcattggaagaaggcttaattgacccttcaacc
tcaatccaaattggtatacgtggttctatgtatgatttaaatgatattaaaatagcagaa
gatttaggattcgaggtcattacagcacataaattacacaaaatgacagaagaagaatta
ggagagaaaattaaaggaagggtaggacagggaaaagcatttttaacatttgacattgat
tttgtagatccggcttatgcccctggtactggaactccagaagttggagggtttacatcc
catgaaacattgtcttatatacaacaactaaaagacattaattttataggatgtgacatt
gtagaggtggctccagattatgactgcagtgaaattactgcatatctggcggcaagtatt
ggctttgaattcatgtctatattggcatgtaaaaagcagtgcctatga

DBGET integrated database retrieval system