KEGG   Clostridium kluyveri NBRC 12016: CKR_2272Help
Entry
CKR_2272          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ckr  Clostridium kluyveri NBRC 12016
Brite
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CKR_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2570619..2572484)
Genome map
AA seq 621 aa AA seqDB search
MEEYKENFVINEINPMESTVTFTNGLVIAKGTVVGDISEKDMRRIQIRETIASHFEKEEK
LFYRGIKTLSLFFIDEVAKYRVYDGNGIEQNSEYAEVFEEEYTSVLNKYITLEDTPYTRY
LKGIDVKDTHKGYFSIDKKTKKIVNSRTNGKSEESDDINAYDLILKNKERFLSFDEPTRF
IFSHSALREGWDNPNIFQICTLKHSNSTIGKRQEVGRGMRLCVDKNGDRVDENYLGIDKN
NIQDINKLTVVASESYKNFAEGLQKDIKEVLYDRPRKAEQEYFVGKKILVNSTSVEISKR
QAKEIYRYLIKNDYIDEDDNVTKNYRLDLANNSLTPLPGELLPMADGVHKLVQSVFDENV
LKDMMEDGNKVKIPENKLNENFYKKEFQTLWNYINHKYAYTVEFDSSELIKKSIRNIDNH
MAVSQLQYTLSQAEQKDNINVNELERGDSFKSVSSKTKTLRHSEIGSIKYDLVGKIAEGA
VLTRKTVVEILKGIHPTVFAMFKYNPEEFITKCIKFIKEEKAAMIVDHITYNQIDGSYDS
NIFTAENMGRDFSRAFLAKKHIQDYVFTDGTAERSVERKFAEDLDGANEVSVYAKLPRAF
HIPTPVGIILLIGQLLLKKVQ
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatataaagaaaattttgtgataaatgagattaatcctatggaaagcactgtc
acttttactaatggacttgttatagctaaaggaactgtagtgggggatatatcagaaaaa
gatatgagaagaatacagataagggagaccattgcatctcattttgaaaaagaggaaaaa
ctgttttacagaggaataaagacactttctcttttctttatagacgaggtagccaaatat
cgtgtctatgatggaaatggtattgaacaaaattccgaatatgctgaggtttttgaggag
gagtatacaagtgttttaaataagtacataacactggaggacactccttatacaagatat
cttaaaggtattgatgtgaaagacacacataaaggttatttcagtattgataagaaaaca
aagaaaatagtgaactcaaggacaaatgggaaaagtgaagaaagtgatgatataaatgct
tatgatttaatacttaaaaataaagaaaggtttttaagctttgatgaacctacaagattt
atattttcacattctgcattaagggaaggctgggacaatcctaatatatttcagatatgc
actttaaaacacagtaatagtacaatagggaaacggcaggaagttggaagaggcatgaga
ttgtgtgtagataaaaatggcgacagggtagatgaaaattaccttggaattgataaaaat
aatatacaggatataaataagcttactgtagttgcaagtgaaagttataaaaattttgcg
gaaggtcttcaaaaggatatcaaagaagttttatatgatagacctagaaaagccgaacaa
gaatattttgtgggcaaaaagatattggttaacagtacatcagtggaaattagtaaaagg
caggccaaggagatatataggtatttgataaaaaatgattatattgatgaagatgataat
gtaactaaaaattatagattggatttggcaaataatagtttaacacctttacctggggaa
ttgctcccaatggctgatggagtacacaaacttgtccagagtgtatttgatgaaaatgta
ttgaaagatatgatggaagatgggaataaggtaaaaatacctgaaaataagttaaatgag
aatttttataaaaaggaatttcagacattatggaattatatcaatcacaaatatgcttat
actgtagaatttgacagcagcgagctcataaaaaaatctataagaaatattgataatcat
atggctgtatcacagctgcagtatacactgtctcaggcagaacagaaggataatattaac
gtcaatgaacttgaaagaggggactctttcaaaagtgtgtcatcaaaaacaaaaacatta
aggcattctgaaataggcagcataaaatatgatctggtgggaaaaattgcggaaggtgcg
gtgcttacaagaaagacagttgtagaaatattaaagggaatacatcctactgtatttgcc
atgtttaaatacaatcctgaagaatttataacaaaatgtattaaatttataaaagaagaa
aaggccgctatgatagttgatcatattacatataatcaaattgatggttcttatgacagc
aatatattcactgcagaaaatatgggaagggatttcagcagggcatttttagctaaaaaa
catattcaagattatgtctttactgatggaactgcagaaagaagtgtagagcgtaaattt
gccgaagatctcgatggagctaatgaagtaagtgtatatgcaaagcttcccagagctttt
catattccaactcctgtgggaattattctcctgattgggcaattgcttttaaaaaaggta
cagtaa

DBGET integrated database retrieval system