KEGG   Clostridium kluyveri NBRC 12016: CKR_2529Help
Entry
CKR_2529          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ckr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2848426..2848983)
Genome map
AA seq 185 aa AA seqDB search
MDKIVCLVGESGSGKSTITELLEKEGYNYIQSYTTRKPRFEGEKGHIFIGDSNIAYINGT
ISKNELTSDVIAYTFFNGNHYWATKEQYQGKGISVYIIDPSGVKYLKEKVTDAETVVIYL
KCDKEVRLLRMLKERDPKAVRDRLKNDREVFKIIQCDYVVDSNRKVEEILEDVKSIIGGE
IFSIE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatagtttgtttagttggggaaagtggaagcggtaagtccactataacagaa
ctgcttgaaaaggagggatataactatatacaatcttatacaaccagaaagccgcgcttt
gaaggcgaaaaagggcatatatttattggagattctaatatagcatatatcaatggaact
atttccaaaaatgaattgacaagtgatgtaatagcttatacattctttaacggaaatcat
tattgggctactaaagaacaatatcaggggaaagggataagtgtttatataatagaccct
tctggagttaaatatttaaaagaaaaggtaacggatgctgaaactgtagttatatattta
aaatgtgataaagaagtaaggctgttaaggatgttaaaagaaagagatcctaaagctgta
agagatagattgaaaaatgatagagaagtttttaaaataattcaatgtgattatgtagta
gattctaatagaaaggttgaagaaattttggaagatgtaaaaagtattattgggggagag
atatttagtattgaataa

DBGET integrated database retrieval system