KEGG   Clostridium kluyveri NBRC 12016: CKR_2646Help
Entry
CKR_2646          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKR_2646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_2646
   00020 Citrate cycle (TCA cycle)
    CKR_2646
   00620 Pyruvate metabolism
    CKR_2646
   00640 Propanoate metabolism
    CKR_2646
   00650 Butanoate metabolism
    CKR_2646
  Energy metabolism
   00680 Methane metabolism
    CKR_2646
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CKR_2646
Enzymes [BR:ckr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CKR_2646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2974282..2975214)
Genome map
AA seq 310 aa AA seqDB search
MEYKFKEEMNKPERLVGGHRMCAGCGAPIAVRSVLRALGEKDKAVIGSATGCLEVSTFMY
PYTSWKDSFVHSAFECAGATMGGVERAYTALRKRGKIKEDYKFITFGGDGGTYDIGFQSL
SGAMERGHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTTPVGAVSSGKSQFRKNLTEIM
VSHNIPYVAQTTFLGNFKDIHEKAHRAIYKKGPAFLNVLSPCPRGWRYETADLMNICKLA
VDTCFWPIFEVEDGKWKLNYKPKNKLPIEDFLRPQGRFKHLFKKGNEYMIAELQEEIDKR
WETLLKKCEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaatttaaagaagaaatgaataagccagaaagattagtgggcggtcataga
atgtgtgctggatgtggtgctcctattgcggtgagaagtgtacttagggctctaggagaa
aaggataaggcagtaataggttctgcaacaggatgtttggaggtttctacatttatgtat
ccatatacatcttggaaggattcttttgtacatagtgcttttgaatgtgcgggagcaact
atgggtggtgtagagagagcatacactgctttaagaaagagaggaaagattaaggaagat
tataaattcataacctttggaggagatggaggaacatatgatataggatttcaatcactg
tctggtgctatggaaagaggccatgacatggtatatgtatgctatgataatggagcatat
atgaatacgggaattcaaaggtcatcagcaactcctaagtatgcagataccacaaccaca
ccagttggagccgtatcatcaggtaaatcacagtttaggaagaatcttacagaaataatg
gtaagccataatataccatatgtagctcagacaacatttttgggaaattttaaagatata
catgaaaaggcccatagggcaatatacaaaaagggaccggcgtttttaaatgtattatcc
ccatgtccaagaggttggagatacgaaaccgctgatttaatgaatatatgtaaattagca
gtggatacatgtttttggcctatttttgaggttgaagatggaaagtggaaattaaattat
aagcctaaaaataagcttccaatagaagacttcttaagaccacagggaagatttaagcac
ttattcaaaaaaggcaatgaatatatgattgctgaattacaagaagagatagataagcgt
tgggaaaccttattaaaaaaatgtgaagaatag

DBGET integrated database retrieval system