KEGG   Clostridium kluyveri NBRC 12016: CKR_2649Help
Entry
CKR_2649          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:ckr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ckr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ckr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ckr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ckr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ckr00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ckr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:ckr00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2976720..2977295)
Genome map
AA seq 191 aa AA seqDB search
MTQLTEIRWHGRGGQGAKTASLLLADVAFSIGKYVQGFPEYGPERMGAPITAYNRISGEK
ILVHSNIYEPDYVVVVDDTLLDVVDVTKGLKKEGAIIINTEKSQEEVKKHLKGYSGNVYI
INAREISEACLGKYFPNTPMLAAVVKVSEVMDENTFIEQMRASFKHKFSSKSEVIEGNMK
ALERSLKEVRK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactaacagaaataagatggcatggtcgaggaggacaaggtgctaaaacagct
tctctactgttggcagatgttgcatttagcataggaaaatatgtacaaggttttccagag
tatggaccagaaaggatgggagctccaataactgcatacaacaggattagtggagaaaaa
atacttgtacattccaatatttatgaacctgattatgttgttgtggtagatgatactctt
ttggacgtagttgacgttacaaaggggcttaaaaaagagggtgcaattataataaacacg
gaaaagagtcaggaagaagtaaaaaaacaccttaagggatattctggtaacgtgtacata
attaatgctagagaaatatcagaggcctgtttaggtaagtattttcctaatactcctatg
cttgcggcagtagttaaggtaagtgaagtaatggatgagaatacatttattgaacaaatg
agagcttccttcaaacataaattttcctcaaaatctgaggtaatagaaggtaatatgaag
gctctagaaaggtctttgaaggaggtaaggaagtaa

DBGET integrated database retrieval system