KEGG   Clostridium kluyveri NBRC 12016: CKR_2663Help
Entry
CKR_2663          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKR_2663
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CKR_2663
Enzymes [BR:ckr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     CKR_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2993724..2995085)
Genome map
AA seq 453 aa AA seqDB search
MSNEVSIKELIEKAKVAQKKLEAYSQEQVDVLVKALGKVVYDNAEMFAKEAVEETEMGVY
EDKVAKCHLKSGAIWNHIKDKKTVGIIKEEPERALVYVAKPKGVVAATTPITNPVVTPMC
NAMAAIKGRNTIIVAPHPKAKKVSAHTVELMNAELKKLGAPENIIQIVEAPSREAAKELM
ESADVVIATGGAGRVKAAYSSGRPAYGVGPGNSQVIVDKGYDYNKAAQDIITGRKYDNGI
ICSSEQSVIAPAEDYDKVIAAFVENGAFYVEDEETVEKFRSTLFKDGKINSKIIGKSVQI
IADLAGVKVPEGTKVIVLKGKGAGEKDVLCKEKMCPVLVALKYDTFEEAVEIAMANYMYE
GAGHTAGIHSDNDENIRYAGTVLPISRLVVNQPATTAGGSFNNGFNPTTTLGCGSWGRNS
ISENLTYEHLINVSRIGYFNKEAKVPSYEEIWG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaagtatctataaaagaattaattgaaaaggcaaaggtggcacaaaaaaaa
ttggaagcctatagtcaagaacaagttgatgtactagtaaaagcactaggaaaagtggtt
tatgataatgcagaaatgtttgcaaaagaagcagttgaagaaacagaaatgggtgtttat
gaagataaagtagctaaatgtcatttgaaatcaggagctatttggaatcatataaaagac
aagaaaactgtaggcataataaaagaagaacctgaaagggcacttgtttatgttgctaag
ccaaagggagttgtggcagctactacgcctataactaatccagtggtaactcctatgtgt
aatgcaatggctgctataaagggcagaaatacaataatagtagcaccacatcctaaagca
aagaaagtttcagctcatactgtagaacttatgaatgctgagcttaaaaaattgggagca
ccagaaaatatcatacagatagtagaagcaccatcaagagaagctgctaaggaacttatg
gaaagtgctgatgtagttattgctacaggcggtgctggaagagttaaagctgcttactcc
agtggaagaccagcttatggcgttggacctggaaattcacaggtaatagttgataaggga
tacgattataacaaagctgcacaggatataataacaggaagaaaatatgacaatggaatt
atatgttcttcagagcaatcagttatagctcctgctgaagattatgataaggtaatagca
gcttttgtagaaaatggggcattctatgtagaagatgaggaaacagtagaaaagtttaga
tcaactttatttaaagatggaaaaataaacagcaagattataggtaaatccgtccaaatt
attgcggatcttgcaggagtaaaagtaccagaaggtactaaggttatagtacttaagggt
aaaggtgcaggagaaaaagatgtactttgtaaagaaaaaatgtgtccagttttagtagca
ttgaaatatgatacttttgaagaagcagttgaaatagctatggctaattatatgtatgaa
ggagctggtcatacagcaggcatacattctgacaatgacgagaacataagatatgcagga
actgtattacctataagcagattagttgtaaatcagcctgcaactactgctggaggaagt
ttcaataatggatttaaccctactactacactaggctgcggatcatggggcagaaacagt
atttcagaaaatcttacttacgagcatcttataaatgtttcaagaatagggtatttcaat
aaagaagcaaaagttcctagctatgaggaaatatggggataa

DBGET integrated database retrieval system