KEGG   Clostridium kluyveri NBRC 12016: CKR_2707Help
Entry
CKR_2707          CDS       T00832                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ckr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ckr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ckr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3043425..3044807)
Genome map
AA seq 460 aa AA seqDB search
MSKVPYRVYLSEEEIPRKWYNLRADMKEQHEPYINPGTMKPAKAEDLYAVFCEELAKQEM
DDKTRYVDIPEEVLNFYKIYRPSPLCRAYNLEKALDTPAKIYYKFEGNNTSGSHKLNSAV
AQVYYAKKQGITSLTTETGAGQWGTALSEACAYFEIPLTVYMVKVSSQQKPYRKAIMETF
GAKVIPSPSDTTEAGRAILAKNPNTGGSLGCAISEAIEHAVKTENCRYVLGSVLNQVLLH
QSIIGLETKAAMEKIDTYPDIVIGCAGGGSNLGGLIAPFMQDKLTEKANPYFIAVEPASC
PSLTRGKYAYDFCDTGKITPLAKMYTLGCEFIPSANHAGGLRYHGMSPILSKLYHDGYMD
EARAVEQTRIFDAAALFAKYETILPAPESSHAIRVAIDEALKCKETGEAKTILFGLTGTG
YFDMQAYIQYNENKMSDYIPTDEDLQKGFDALPSIPGIQD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtaccttatagagtttatttgtcagaggaggaaataccacgtaagtggtat
aatcttagggctgatatgaaagaacaacatgagccttacataaatccaggcactatgaaa
cctgcaaaagctgaagatttatatgctgtattctgtgaagaacttgcaaaacaagaaatg
gacgacaaaactagatatgtagatattccagaggaggttcttaatttctataaaatctat
cgtccgtcacctctttgtcgagcatataatctggaaaaagcgctggatacacctgcaaag
atttattacaagtttgagggaaataacacttctggtagccataagctgaattctgctgta
gcacaggtttattatgcaaagaaacaagggattacttcccttactacagaaactggagct
ggtcaatggggcacagctttatctgaagcttgtgcatactttgaaatacctttaacagtt
tatatggttaaggtatcttcccagcagaagccttatcgaaaggcaattatggaaaccttt
ggagcaaaagttattccaagtccatcagatacaaccgaagctgggcgtgctattcttgct
aagaatccaaatacagggggcagtcttggatgtgctatttctgaagctattgaacatgca
gtaaaaacggaaaactgtcgctatgttttgggctctgttcttaatcaagttctccttcac
caatcgattattggtcttgaaactaaagcggctatggaaaaaattgatacttatcctgat
atagtcataggctgtgccggtggaggctctaatcttggtggacttattgctccttttatg
caggataaattaactgaaaaagctaatccttattttatagcagttgaacctgcctcttgt
ccatctcttactagaggaaaatatgcctatgatttttgcgatacgggaaaaatcactcct
ctggcaaagatgtatacattaggttgtgagttcattccttctgctaaccatgcaggtggg
ttacgttatcatggcatgagtccaattctttcaaagctttatcatgatggatatatggat
gaagctcgtgctgtagagcaaacaaggatatttgatgctgctgcattgtttgcaaagtat
gaaacaatacttcctgctccagaatcttcccatgcaattcgtgtggctatcgatgaagca
cttaaatgtaaagaaacaggagaggcaaagacaattttattcggtcttacaggaactggt
tattttgatatgcaggcatatatacagtataatgaaaataaaatgtctgattatatccct
acggatgaggatcttcaaaagggattcgatgctttaccgagtatccctggtattcaagat
taa

DBGET integrated database retrieval system