KEGG   Clostridium kluyveri NBRC 12016: CKR_2866Help
Entry
CKR_2866          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ckr  Clostridium kluyveri NBRC 12016
Brite
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CKR_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3238737..3241715
Genome map
AA seq 992 aa AA seqDB search
MIGGYVMELILQRGLPHQQKAVDAVSAALNGVQIASPVQFYENPSISLSDPKLAANIREI
QKNIPAEYRSSMPISDCLNIDIKMETGTGKTYVYTHTIYELHKRYGLNKFIIAVPSLAIK
AGTAQFLRDEYVKRHFSDVCGYGTEIEVGVLETPKNKKKGRSYFPSVVSDFVKGSCQNTK
KIYVLLVNMQLLVVRSNGMLSRDDYDYGVEGFYRPLDAIRATNPVVIIDEPHRFSRDQKA
FKVIVDEIKPQCIIRFGATFPETTSGRGKNKITVKDYQNLLYDLNACESFNQNLIKGVTK
EHFEPVSKREEKVKITSITSKDSVTFQYKKRDESTKTFTLKTGDSLSIINEAFEGITVHA
IGKSTVEFSNGIQKSTGEELDVDIYMTSYQEQMMRLALERHFETEKTNFCGRNFKIKTLA
LFFIDDISSYRPNEEGKTPYLLQAFERLLKERIESVLSTLSEHDTEYRAYLEASLADISA
CHAGYFSQDNSDSDEDIAKEVETILHGKKHLLSFKNKDGSYNTLRFLFSKWTLKEGWDNP
NVFTIAKLRSSGSENSKLQEVGRGLRLPVDENGNRISNEEFQLNYIVDFTEADFAKRLID
QINGEIPQASSISEERLEQVAKKLGMTSDELFDALYDKHYIDRRLNIKPDTRDAFFAEYP
DFATGLSSGKVKDRNVAKPRPVKIRKAVYSEIRELWEAINQRYLLFYDDDLDADMAKVVL
SLLEKPGVFTDIVMTSSRDIVKSDGSQMMIVSDTGAQYIVSKPIPYNEFLKRITNATNIP
IKILHEALCEYVKRNGTINPEHINENSVSMFIQQFHDWRSNNLQGRFHYAKSNTPVGATA
LTYSDGSPREDIAQGRIGTKIAPGTPSEKYLYDAFAYDSPLEQKNIMSDIEEVIVYGKIP
RSSIAIPTITGGMYSPDFMYVVRKASGEKELNIVVETKDVENKSDLRGTEKAKIDCARVF
FDMLSKDGYTVYFRDQLNNKQMAQIIKEVLAE
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
ttgattggagggtatgttatggaacttatcctacaacgaggattaccacaccaacaaaaa
gctgtagatgcagtaagtgctgctttgaatggggtacagatagcttctcctgtacaattt
tatgaaaatccaagtatttctctttctgaccctaaactagctgcaaatattagagaaatt
caaaaaaatatacctgcagaatatcgaagcagtatgcctattagtgactgcttgaatatt
gatattaaaatggaaactggtacaggaaagacttacgtttatactcatactatatatgag
cttcataaacgttacggacttaataagtttattatcgctgtaccttcacttgcgattaaa
gcaggaaccgcacagtttttgcgtgatgaatatgtaaagcgacatttttccgatgtttgt
ggttatggtacagaaattgaggttggagtactagaaacaccaaaaaacaagaaaaagggg
cgctcctatttcccgagtgttgtgagcgactttgtaaaaggttcttgccagaacacgaag
aagatttatgtattattagttaatatgcaactacttgttgtccgatcaaatggtatgctt
agccgtgacgactatgattatggagtagaaggtttttatagaccacttgatgctattcgt
gcaacaaaccctgttgttattattgatgagccacacagattttctcgtgaccagaaggca
tttaaggttatcgttgatgaaataaaaccacagtgtattatacgctttggtgctaccttc
cctgaaactacaagtggacgtggaaaaaacaaaataaccgtaaaagactaccaaaacctg
ctctatgatttaaatgcctgtgaatcttttaatcaaaatttgataaagggagtaacgaag
gagcattttgaaccggtatccaagcgtgaagaaaaggtgaaaatcacttccatcacaagc
aaggattctgttacctttcagtataaaaagcgtgatgaatcgactaaaacatttactctt
aaaactggagattcactatctatcattaatgaagcttttgagggaattacggttcatgct
attggtaaatcaacagttgagttttctaatggtattcaaaagtcaactggtgaggaattg
gatgtggatatctatatgacctcttatcaagagcagatgatgcgtcttgcccttgagcgt
cattttgaaacagaaaaaacaaacttctgtggtcgcaatttcaagatcaagacattggca
ttattttttatcgatgatatatcatcatatcgaccaaacgaggaaggtaaaaccccttat
ctattgcaagcttttgagagattgcttaaggaacggatagaatcggtgctatctaccctc
agtgagcatgatacagaatatcgggcatatctggaagcaagtcttgcagatatttctgct
tgccatgcaggctatttttcacaggacaatagcgattcggatgaagatatagcaaaagaa
gtagaaaccatccttcatggaaaaaaacatcttctctctttcaagaataaagacggtagc
tataacactttacgttttctattttcaaaatggacacttaaagagggctgggataaccct
aatgtatttacgatagctaaacttcgttctagcggaagtgaaaatagtaaactgcaagag
gttggacgaggtttacgtctacctgtagatgagaatggtaatagaatctccaatgaagaa
ttccagcttaattatattgttgacttcacagaggcagactttgctaaacgattaatagac
caaataaacggagaaattccacaagcttcttctattagcgaagaaagattggaacaagtg
gccaagaagcttggcatgacttcagatgaactttttgatgcactatatgataaacattac
atagacaggcgattaaatataaaacccgatacaagggacgctttctttgcagaatacccg
gactttgctacaggattgtcttcaggtaaggtaaaagaccgaaatgtagcaaaaccaaga
cctgtaaaaatccgcaaagctgtttacagtgaaatacgcgaattatgggaagcaatcaat
caacgatacctacttttctatgatgatgatctggatgctgatatggctaaagttgtttta
tctttgctggaaaaacccggtgtttttacagacattgtcatgactagctccagagatatc
gttaagagcgatggctcacagatgatgattgtttcagatacaggcgctcaatatatagta
tccaaacctattccctacaatgaatttcttaagaggatcacaaatgctacaaacattcca
attaaaatattgcatgaagcattgtgtgagtatgttaagaggaatggaactattaatcca
gaacatattaatgaaaattctgtcagcatgtttatccaacaatttcatgactggagaagc
aataatttgcaaggtcgattccattatgcaaaaagcaatacacctgttggtgcaacagca
ctcacctattcagacggttctccacgtgaagatatcgcacagggacgtatcggcacaaag
atagctccgggaacaccaagcgagaagtatttatatgatgctttcgcttatgactcaccg
ttggaacaaaaaaatattatgtcggacatcgaagaagtcattgtatatggaaaaattcca
cgtagcagcattgccataccaactattaccggtggaatgtacagtccagacttcatgtat
gttgtaagaaaggcttccggtgagaaagagcttaacattgtagtcgaaacaaaagacgta
gaaaataaatccgacttacgtggtacagaaaaagcaaaaattgattgtgctcgtgttttc
tttgatatgctctcgaaagatgggtacactgtttatttccgtgatcagttaaacaacaaa
cagatggctcagattattaaagaagtattggcagagtaa

DBGET integrated database retrieval system