KEGG   Clostridium kluyveri NBRC 12016: CKR_2971Help
Entry
CKR_2971          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00040  Pentose and glucuronate interconversions
ckr00052  Galactose metabolism
ckr00500  Starch and sucrose metabolism
ckr00520  Amino sugar and nucleotide sugar metabolism
ckr01100  Metabolic pathways
ckr01130  Biosynthesis of antibiotics
Module
ckr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKR_2971
   00052 Galactose metabolism
    CKR_2971
   00500 Starch and sucrose metabolism
    CKR_2971
   00520 Amino sugar and nucleotide sugar metabolism
    CKR_2971
Enzymes [BR:ckr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CKR_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAH08022
UniProt: B9E697
Position
3346257..3347138
Genome map
AA seq 293 aa AA seqDB search
MSIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYVVEEAVNSGIEEILIILGKNK
KSIEDHFDKSVELEDELKSSHKDGLLELIQNISNMVNIYYVRQKEPKGLGHAISLAKAFV
GNEAFAVILGDDIVDSEVPCLKQLINCYNKYNTSIIGVQPVNRKDVSKYGIIDGIQIDDK
VHKIKNMVEKPGKEEAPSNIAILGRYIITPEIFDILERTKPGKGNEIQLTDALKELLKQE
AIYSYCFEGKRYDIGDKLGFIEANIEYALKRTDLRENLISYISDINKKLELNF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaaaaagcagtaattcccgctgctggtttaggaacaagatttttgcctgct
acaaaagcacaacctaaagaaatgttaccaatagtagataagcctacaattcaatatgtg
gtagaagaggccgttaactctggtattgaagaaatattgataatcttaggtaagaataaa
aaatctattgaagatcattttgataaatccgtagaacttgaggatgaattaaaaagcagc
cataaagatggtttgctcgaattgattcaaaatataagtaatatggtaaatatatattat
gtacgtcaaaaagaaccaaaaggattgggtcatgccataagccttgcaaaggcctttgta
ggtaatgaagcttttgctgttatattgggagatgatatagtagatagtgaagtgccctgc
ttgaagcagctaattaactgctataacaagtataatacttcaattataggagtacagcct
gttaacagaaaagatgtatccaaatatggaattattgacggtatacaaatagatgataaa
gttcataagataaaaaatatggtagaaaagcctggaaaagaagaagctccatccaatatt
gccatactggggagatatataataacaccagaaatatttgatatactggagagaactaaa
cctggaaagggtaatgaaattcaacttacagatgcattaaaagaattattaaagcaggag
gcaatatactcttattgttttgaaggtaagcgatatgatataggtgacaagctaggattc
attgaggctaatatagaatatgccttaaaacgtacagatttaagagaaaatcttatttct
tatatttcagacatcaataaaaaattagaactaaatttttaa

DBGET integrated database retrieval system