KEGG   Clostridium kluyveri NBRC 12016: CKR_2987Help
Entry
CKR_2987          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00010  Glycolysis / Gluconeogenesis
ckr00051  Fructose and mannose metabolism
ckr00562  Inositol phosphate metabolism
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01120  Microbial metabolism in diverse environments
ckr01130  Biosynthesis of antibiotics
ckr01200  Carbon metabolism
ckr01230  Biosynthesis of amino acids
Module
ckr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ckr_M00002  Glycolysis, core module involving three-carbon compounds
ckr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_2987
   00051 Fructose and mannose metabolism
    CKR_2987
   00562 Inositol phosphate metabolism
    CKR_2987
Enzymes [BR:ckr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CKR_2987
Exosome [BR:ckr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CKR_2987
  Exosomal proteins of bladder cancer cells
   CKR_2987
  Exosomal proteins of melanoma cells
   CKR_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAH08038
UniProt: B9E6B3
Position
complement(3362409..3363155)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKNLEDALELVEELKPLVRGAKCDVVLCPPYVCLDAVVKSVGGTNIKV
GAQNMHYEESGAYTGEISPGMLKSLKVDYVIIGHSERRQYFNEKDETINKKIKKAFEHDI
IPIVCCGESLLERENGITEEVLGRQIKLALKDLRKEQVEKIVIAYEPIWAIGTGKTATDK
QANDTIAHIRGVVSKMYGENAAEVVRIQYGGSVKPATIKAQMEQPHIDGALVGGASLKPQ
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaataatagcgggaaattggaaaatgaataaaaatctagaggatgctttg
gaactggttgaagaattgaagcctcttgtaaggggtgcaaagtgtgatgtagttttatgt
ccgccttatgtttgtcttgatgcagtggttaaatcggtaggtggaaccaatataaaagtt
ggagcacagaatatgcattatgaagaaagtggtgcctacacaggggaaatttctccaggg
atgttaaagtcccttaaagtagattatgttataatcggacacagtgaaagaagacagtat
tttaacgaaaaagatgagacaataaataaaaagataaaaaaagcctttgagcatgatata
atccctatagtttgctgcggggaaagtcttttggagagagaaaatggtataacagaagaa
gtactgggcaggcagataaaactggcacttaaggatctcagaaaggaacaggtggaaaag
attgttatagcttatgaacccatatgggctataggaacaggtaaaactgccacagataaa
caggcaaatgatacaatagctcatataagaggtgtagtttcaaaaatgtatggagaaaat
gcagcagaagtagtaagaattcaatatggaggctctgtaaaacctgctacaattaaagcc
cagatggaacaaccgcatatagatggagcattagttggaggagccagcttaaagccacaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system