KEGG   Clostridium kluyveri NBRC 12016: CKR_2987Help
Entry
CKR_2987          CDS       T00832                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKR_2987 (tpiA)
   01230 Biosynthesis of amino acids
    CKR_2987 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_2987 (tpiA)
   00051 Fructose and mannose metabolism
    CKR_2987 (tpiA)
   00562 Inositol phosphate metabolism
    CKR_2987 (tpiA)
Enzymes [BR:ckr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CKR_2987 (tpiA)
Exosome [BR:ckr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CKR_2987 (tpiA)
  Exosomal proteins of bladder cancer cells
   CKR_2987 (tpiA)
  Exosomal proteins of melanoma cells
   CKR_2987 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3362409..3363155)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKNLEDALELVEELKPLVRGAKCDVVLCPPYVCLDAVVKSVGGTNIKV
GAQNMHYEESGAYTGEISPGMLKSLKVDYVIIGHSERRQYFNEKDETINKKIKKAFEHDI
IPIVCCGESLLERENGITEEVLGRQIKLALKDLRKEQVEKIVIAYEPIWAIGTGKTATDK
QANDTIAHIRGVVSKMYGENAAEVVRIQYGGSVKPATIKAQMEQPHIDGALVGGASLKPQ
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaataatagcgggaaattggaaaatgaataaaaatctagaggatgctttg
gaactggttgaagaattgaagcctcttgtaaggggtgcaaagtgtgatgtagttttatgt
ccgccttatgtttgtcttgatgcagtggttaaatcggtaggtggaaccaatataaaagtt
ggagcacagaatatgcattatgaagaaagtggtgcctacacaggggaaatttctccaggg
atgttaaagtcccttaaagtagattatgttataatcggacacagtgaaagaagacagtat
tttaacgaaaaagatgagacaataaataaaaagataaaaaaagcctttgagcatgatata
atccctatagtttgctgcggggaaagtcttttggagagagaaaatggtataacagaagaa
gtactgggcaggcagataaaactggcacttaaggatctcagaaaggaacaggtggaaaag
attgttatagcttatgaacccatatgggctataggaacaggtaaaactgccacagataaa
caggcaaatgatacaatagctcatataagaggtgtagtttcaaaaatgtatggagaaaat
gcagcagaagtagtaagaattcaatatggaggctctgtaaaacctgctacaattaaagcc
cagatggaacaaccgcatatagatggagcattagttggaggagccagcttaaagccacaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system