KEGG   Clostridium kluyveri NBRC 12016: CKR_3086Help
Entry
CKR_3086          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKR_3086
Enzymes [BR:ckr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CKR_3086
Exosome [BR:ckr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKR_3086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3476750..3478738)
Genome map
AA seq 662 aa AA seqDB search
MWEVILRVPNKDINLFYKGESYNSYKFMGSHFTKERGKFGTRFTVWAPKAVAVRVLGDFN
NWNPRDGDNLERIWGKDLWSGFIIGVKKESIYKYEIIDKNGKSVLKSDPYARYSEKRPRN
ASKIIGKKTFKWEDSKWISKRKTQNVYKSPINIYEVHLGSWKKDENGNFLNYRDIAKQLV
KYLKTMNYNYVEILPIMEHPLDDSWGYQITGYYSVTSRYGSIEDFKYFINMCHIEDIGVI
LDWVPGHFCKDEHGLYKFDGTPTYEYEDEKQSENKSWGAGNFDLGKPEIKSFLISNALFW
LREFHIDGLRVDAVANTLYLDYDKGPGQWTANEYGGNENLSAVKFYRELNTALFKEFPNL
IMIAEESTAWPMVTAPSYCGGLGFNFKWNMGWMNDVLKYIKMSPKERTYNHRLLTFSIMY
NYSENFILPISHDEVVHGKCSLVDKMWGDYFDKFAGLRVFITYMYTHPGKKHIFMGTEFA
QFSEWRSSGQLDWELIDKFPMHKKTLGFFEKINKFYISEKPLWELDHIEKGFEWIDADNS
NQSILVFMRKSSQENNILIIICNFKLEVYSNYNIGVPYFGEYQEVFNTDEKEFGGSGEIA
NDIVYSKNKEYHNQKFCLTVKIPPMAAIILKPKKIYPNTIEQKLIISSKDESKDKMSLKK
QK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaggtgatattaagagtgcctaataaggatataaatcttttctacaaaggagaa
agttataatagttataaatttatgggatcacattttactaaggaaagaggtaaatttgga
actaggttcactgtatgggcacctaaggctgttgcagtaagagtactaggagattttaat
aattggaatcctagagatggggataacttggaaagaatatggggaaaagatttgtggagc
ggcttcattataggggtaaaaaaggaatctatatacaaatatgaaattatagataaaaat
ggcaaatctgttttgaaatcagatccttatgctagatattctgaaaaacgaccgagaaat
gcatctaaaataattggaaagaaaactttcaagtgggaagatagtaaatggatatccaaa
aggaaaacacaaaatgtatataaaagtcctataaatatatatgaagtacatcttggttcg
tggaaaaaggatgaaaacggcaactttttgaattatagagatatagcaaaacaacttgta
aaatatttaaagactatgaattataattatgtggaaatacttcctataatggaacatcca
ttagatgactcttggggatatcaaattacgggatattattctgtaactagcaggtatggc
agcatcgaggactttaaatactttataaatatgtgccatatagaggatattggagtgata
ttggattgggtaccaggccacttttgtaaagatgaacatggattatataagtttgacggt
acaccaacttatgaatatgaagatgaaaagcaatctgaaaataaatcttggggagcggga
aattttgatttggggaaaccagaaattaagagttttttaatatcaaatgccttattttgg
ttaagagaatttcacatagatggacttagggtggatgccgttgcaaatacactttatcta
gattatgataagggtccaggtcaatggacagccaatgaatatggcggaaatgaaaattta
agtgccgttaaattttatagggaattaaatactgcactttttaaggaatttccaaattta
attatgattgcagaagaatctactgcatggccaatggtcacagcaccttcatattgtgga
ggattaggatttaattttaaatggaacatgggttggatgaatgatgtattaaaatatatt
aaaatgagtcctaaagagagaacatataatcatagattacttactttttcaattatgtat
aattattctgaaaattttattcttcctatatctcatgacgaagtggtccatggtaaatgt
tctcttgtagataaaatgtggggagattattttgataaatttgcagggcttagagtgttt
attacctatatgtatactcatcctggtaaaaaacatatatttatgggaacggagtttgca
cagttttcagaatggaggagttcaggtcaattggattgggagcttatagacaagtttcct
atgcataagaaaactctaggtttctttgaaaaaataaataaattttatataagtgaaaag
ccattatgggaacttgaccatattgagaagggatttgaatggatagatgcagataattca
aatcaaagtatattagtgtttatgagaaagtccagccaggagaataatattttaataata
atctgcaattttaaattagaagtttattctaattacaatataggagttccatatttcgga
gaataccaggaagtatttaatacagatgaaaaagaatttggagggtctggagaaatagct
aatgacatagtgtattctaaaaataaagaatatcataatcaaaaattttgtctaactgtt
aaaatacctcctatggctgctattatattaaaacccaaaaaaatatatcctaatactata
gaacaaaagttgattataagttccaaagatgaaagtaaagataaaatgtcattaaaaaaa
caaaaataa

DBGET integrated database retrieval system