KEGG   Clostridium kluyveri NBRC 12016: CKR_3138Help
Entry
CKR_3138          CDS       T00832                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKR_3138
   01230 Biosynthesis of amino acids
    CKR_3138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKR_3138
   00030 Pentose phosphate pathway
    CKR_3138
   00051 Fructose and mannose metabolism
    CKR_3138
   00052 Galactose metabolism
    CKR_3138
  Energy metabolism
   00680 Methane metabolism
    CKR_3138
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CKR_3138
Enzymes [BR:ckr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CKR_3138
Protein phosphatases and associated proteins [BR:ckr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CKR_3138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3536272..3537243)
Genome map
AA seq 323 aa AA seqDB search
MGGLCMKKIAVLTSGGDAPGMNAAIRAVVRTALDKNFNILGIERGYRGLMNGEVVPMERE
SVADIIQRGGTILKTARSEEFKTDKGKKIAVGILEKFQVDGLIVIGGDGSFKGAQELSKL
GIATIGIPGTIDNDLAYTDFTIGFDTATNTVLDAINKLRDTSTAHQRVSIVEVMGRNCGD
IALYAGLAGGAENIIIPEKGYEEEELCKNVLEAKLNGKVHNLIVLAEGIGGGEALAKKIQ
YVTGIEARATKLGHIQRGGSPTCRDRILASRFGYRAVELLEEGKTSRVIGIKEEKIIDLN
IDEALNTPRKFDEKLYEIAEALA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtttgtgtatgaaaaaaatagctgtgttaactagtgggggagatgcaccaggt
atgaatgctgccataagagcagtggtaaggactgccttggataagaatttcaatatactg
gggatagaaagaggatataggggactcatgaatggagaagtagtacctatggaaagagaa
agtgtggcagatattatacagcggggaggtactatattaaagactgccagatcggaagag
tttaaaacagataaaggtaaaaaaatagctgtaggtatactggaaaagtttcaagtagac
ggattgatagtaataggtggagatggctccttcaagggagctcaggaattatccaaatta
ggcatagctaccattggcatacctggaactatagataatgacctagcgtatacggacttt
accataggatttgatacggcaacaaatacagttttagatgcaattaataagttaagagat
acttctacagcccatcaaagggtaagtattgtagaagttatgggaagaaactgtggagat
atagctctttatgcaggacttgccggtggggctgaaaatataattataccggaaaaagga
tatgaagaagaagaattgtgtaaaaatgtattggaggcaaagctaaatggcaaagtgcat
aatttgatagtgttagcagaaggtataggagggggtgaggctttagcgaaaaagatacag
tatgttactggaatagaagctagagctacaaaattaggacatattcagcgaggaggcagt
cctacttgcagggatagaatattggcttcaaggtttggatatagagcagttgagctattg
gaagagggaaaaacttcacgagttattggtattaaagaggaaaagattattgatttaaac
atagatgaggccttaaatacgccaagaaaatttgatgagaaactatatgaaatagcagaa
gcattagcatga

DBGET integrated database retrieval system