KEGG   Clostridium kluyveri NBRC 12016: CKR_3240Help
Entry
CKR_3240          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKR_3240
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CKR_3240
DNA repair and recombination proteins [BR:ckr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CKR_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD HHH_5 PIF1 DNA_pol_lambd_f PhoH UvrD_C AAA_22 T2SSE DEAD NTPase_1 SRP54 DUF2075 Herpes_Helicase AAA HHH_2 AAA_10 RsgA_GTPase AAA_24 AAA_12 DUF853 AAA_29 TrwB_AAD_bind cobW HHH_3 AAA_28 MobB ABC_tran UvrD-helicase AAA_5 CbiA AAA_16 Flavi_DEAD ResIII
Motif
Other DBs
NCBI-ProteinID: BAH08291
UniProt: B9DX48
Position
complement(3642915..3645176)
Genome map
AA seq 753 aa AA seqDB search
MSYMQELQGVVEDIIFQNKDNGYTVAKIKEKEDTITIVGCIPYIIEGQNLEVSGEWVVHP
EFGHQFKVKLFKEIIPDTLVGIEKYLSSGIISGIGPVTAKKIVEKFGKDTLHILDNNIER
LKEIEGIGSKKISLIEKSYCKQYEIRNIMIFMQTYGVTPNQCVKIYKKLGVNSINIVKEN
PYILTEEISGIGFKIADKIARGLGIEKDSPFRVQSGIKYLINKFCSRGNTYVPIDVLIRN
GMSILGVSQKELEKNIYESSLNGKIKVEKYGDKICVFSMTYYYCELSVTKKILTLAFNKC
KDIDLNIYEEIKNFEKANNIKFAFSQKEAIKGSVENSVEIITGGPGTGKTTIINCMIQLF
EKSNLKVLMAAPTGRAAKRMSEATKREAKTIHRLLEIGVESDDEALFFSRGEESPLQCDV
VIIDEASMIDIVMMNNLLKAISLKTRLIIVGDSEQLPSVGPGNVLRDLIDSRCIKVVRLK
EIFRQSRESMIIVNAHKINLGEMPILNKKLKDFYFIKALEFSNILNLLVELANKRLPAFN
GHWDKMKHIQILSPMRKGILGVSNLNRKLQEALNPKSNNKKEKYFRDMIFRVGDKVMQIK
NNYTLKWTVISGEKEEKGMGIFNGDFGYIEDIDEEKDTVTVIFDEEKRVVYDSICLDELD
LAYGITIHKSQGSEFPVIIVPMFMGPVLLMNRNLLYTAITRAKEMVVLVGDLRALTFMIS
NNKSFERYSLLKYRIMDIMESEVDVTLEQNEFR
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
gtgagttatatgcaggaattacagggagttgtagaagatataatatttcaaaataaggat
aatgggtacacagtggctaagataaaagagaaagaagatacaataactatagttggatgt
ataccttatataatagaaggacaaaatttggaggtttcaggagagtgggtagttcatcct
gaatttggccatcaatttaaagttaaactgtttaaagagataattccagataccttagtt
ggcatagaaaagtatctgtcttcaggtattatatcaggcataggaccagttactgcaaaa
aagatagtagaaaagtttgggaaagatacactccatatattagataacaatatagaaagg
ttaaaagaaatagagggcataggatcaaaaaagatatccttaatagaaaaatcttattgt
aagcaatatgaaataagaaatataatgatatttatgcaaacttatggagtaacccctaat
caatgtgtaaaaatatacaaaaagttgggagttaactcaataaatatagtaaaagaaaat
ccctatattcttacagaagaaatatcaggaataggattcaaaatagcagataaaatagca
agaggtcttggcatagaaaaggattctccctttagagtacaaagtggtataaaatattta
ataaataaattttgcagcagaggaaatacttatgtgcccatagacgtattgataagaaat
ggaatgagtatacttggagtgagtcaaaaggaactggagaaaaatatatatgaaagctcc
ttaaatggaaaaataaaggtagaaaaatacggagataagatttgtgtattctccatgaca
tattattattgcgaattaagtgtaactaagaagatattgacattagcttttaataagtgt
aaagatatagatttaaatatatatgaggaaattaaaaattttgaaaaggccaataacata
aaatttgctttttcacaaaaagaagcaattaaaggatcagtagaaaatagtgtagaaata
ataacaggagggcctggaacaggaaagactactattattaattgtatgattcagttattt
gaaaaatcaaacttgaaagtccttatggcggcacctactggaagggctgcaaagagaatg
tcagaggcaactaaaagagaggcgaaaactatacatagattacttgaaataggtgtagaa
agtgatgatgaagcattatttttttctcgtggagaagaatctccccttcaatgtgatgtg
gtaattatagatgaagcctctatgatagatatagtaatgatgaataatttattaaaagct
atttcattaaaaactagacttataatagtaggagattcagagcagcttccttctgtagga
cctggaaatgtacttagagatctgatagatagccggtgcattaaggtagtcagattaaaa
gaaatatttagacagtcaagagagagcatgattatagtaaatgcccataaaataaattta
ggagaaatgccgatcctaaataaaaaacttaaagatttttattttataaaagccttggaa
ttctccaatatattaaatcttctagtagaattagcaaataaaagattacctgcatttaat
ggacattgggataaaatgaaacacattcaaatactatctcccatgagaaaaggaatttta
ggagtatcaaatttaaatagaaaacttcaggaagctttaaatcctaaaagtaataataaa
aaagaaaagtattttagagatatgatttttagagttggagataaggtaatgcaaattaaa
aataactatactttaaagtggacagtaatttcaggagaaaaagaggaaaaaggtatgggc
atttttaatggagattttggatatattgaagatattgatgaagagaaggatacagtaact
gttatatttgacgaagagaaaagagttgtatatgacagtatatgtttagatgaattagat
ttagcttatggaataactatacataaaagccaggggagtgaatttccagttattattgtt
cctatgtttatggggccggttttacttatgaataggaatttactatatacagctataact
agggcaaaagagatggtggtacttgtaggagatttaagagctttaacctttatgataagt
aataataaaagttttgagaggtattccttattaaaatatagaataatggatataatggag
agtgaagtggatgttactttggaacaaaatgagtttcgctga

DBGET integrated database retrieval system