KEGG   Clostridium kluyveri NBRC 12016: CKR_3288Help
Entry
CKR_3288          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00900  Terpenoid backbone biosynthesis
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKR_3288
Enzymes [BR:ckr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CKR_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAH08339
UniProt: B9DX96
Position
complement(3696150..3696992)
Genome map
AA seq 280 aa AA seqDB search
MLIKAYAKINLSLDVIGKREDGYHLLKMIMQTIDLYDLLNITPIEKGIEIKCNKSYIPCD
KRNLVYKAVELFASNYGIKSGVSIDIIKNIPVAAGLAGGSSDAAAVLKVMRDIYIPELEY
KDLIKLGTSIGADVPYCMIGGTALCQGIGEKVTSISSFKNHILVLVKPFFGVSTAEVYKS
LDISKIKIHPNTDILINAINSGSLLKVSKNMKNVLENVTLKKHPLLRKIKNELIDFGALG
ALMSGSGPSIFAFFDDMLKAQICYDKMKTKYKEVFITRTV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaaagcctatgccaaaataaacctttcattagatgtaataggaaaaagagaa
gatggatatcatcttttaaagatgataatgcaaactatagatttatatgatcttttaaat
ataactcctattgaaaaaggaatagaaataaaatgtaataagtcatatattccatgtgat
aaaagaaatttagtatataaggcagtagaattatttgcaagcaactatggcataaaaagt
ggagtaagtatagatataattaaaaatatacctgtagcagctggacttgcgggaggaagt
tcagatgcagctgcagtattaaaagttatgagagatatatacatacctgaattagaatat
aaagatttaattaaattaggaacaagcattggggcagatgtaccttattgtatgataggg
ggaactgctctatgccagggtataggagaaaaagttacatctatttcttcttttaaaaat
catattttagtattagttaaaccattttttggcgtaagtactgcagaggtatataaaagt
ttggatataagtaaaataaagattcatcccaatacggatatattaataaatgccataaat
tcaggttcgctgttgaaagtgagtaaaaatatgaaaaatgtattggaaaatgtaacttta
aaaaaacaccctttattaagaaaaataaaaaatgagttaattgattttggtgcattaggt
gctttgatgagtggaagtggtccaagtatatttgctttttttgatgatatgttaaaagca
caaatatgttatgataaaatgaaaactaaatataaagaagtgtttattacaagaactgta
taa

DBGET integrated database retrieval system