KEGG   Clostridium kluyveri NBRC 12016: CKR_3367Help
Entry
CKR_3367          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
Organism
ckr  Clostridium kluyveri NBRC 12016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3791537..3792556)
Genome map
AA seq 339 aa AA seqDB search
MFLEKLCNSTGPSGYEEHIRNVIRDELSTFTDNILIDRMGNIIVHKDRQNDSSSKIMVIS
HIDESGLIITAYNKDGTLKFSTLGDIDKNSLPAKAVLIGDKKIPGVIGMKPIHIQSKKER
DENISYENMCIDIGAFSQEECRRIISLGDFVVFNNKFSHFGDNLLKGKALDNRVGCSILI
ELLKEDLNCNLYGVFNVQGNIDQRGIHAVAYNIDPDLVIILDTINSIDYMEIPSYFRTSK
LREGPVIPFKGGQCIFDRGIVESIRNKADDIGIPYQKIGDTHGEGELKAAYLTVNNCKTA
SILLPCRYMNFNISICSLADYDNTLFLLKSYLEDCSINI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttagaaaaactctgtaattctacaggaccttcgggatatgaggaacacattagg
aatgtaataagagatgaattaagtacttttactgacaatatacttatagatagaatggga
aatattatagtgcataaggatagacaaaatgattcttcatctaaaataatggtgatttct
cacatagatgaatcaggtctcataataacagcttataataaagatggaacactaaaattt
tccacattaggggatatagataaaaattcacttcctgctaaggctgttttaattggagat
aaaaaaataccaggagttattggaatgaagccaatacatattcagagtaaaaaagaaaga
gatgaaaatatatcctatgaaaatatgtgtatagatataggcgctttttcccaagaggaa
tgtagaaggattatatcattaggggattttgtagtatttaataataaattttctcatttt
ggagataaccttttaaaaggaaaagctctagataatagagtaggatgttctatacttata
gagttattgaaggaagacttaaattgcaacttatatggtgtatttaatgttcagggaaat
atagaccaaagaggaattcatgcggttgcttacaatattgatccagatttagtcataatt
ttagataccataaatagtatagattatatggaaattcccagttatttcaggacaagtaaa
ttaagagaaggtcctgttataccttttaaaggtggacagtgtatattcgatagaggtatt
gtagaatctatccggaataaagcagatgacataggaataccatatcaaaaaattggagat
actcatggagaaggagaacttaaagcagcttatcttactgttaataattgtaaaactgca
tcgatattattaccatgtagatacatgaattttaatatttctatatgcagtttagctgat
tatgataatactttatttttattaaaaagctatttagaggactgtagtataaatatttag

DBGET integrated database retrieval system