KEGG   Clostridium kluyveri NBRC 12016: CKR_3367Help
Entry
CKR_3367          CDS       T00832                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ckr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3791537..3792556)
Genome map
AA seq 339 aa AA seqDB search
MFLEKLCNSTGPSGYEEHIRNVIRDELSTFTDNILIDRMGNIIVHKDRQNDSSSKIMVIS
HIDESGLIITAYNKDGTLKFSTLGDIDKNSLPAKAVLIGDKKIPGVIGMKPIHIQSKKER
DENISYENMCIDIGAFSQEECRRIISLGDFVVFNNKFSHFGDNLLKGKALDNRVGCSILI
ELLKEDLNCNLYGVFNVQGNIDQRGIHAVAYNIDPDLVIILDTINSIDYMEIPSYFRTSK
LREGPVIPFKGGQCIFDRGIVESIRNKADDIGIPYQKIGDTHGEGELKAAYLTVNNCKTA
SILLPCRYMNFNISICSLADYDNTLFLLKSYLEDCSINI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttagaaaaactctgtaattctacaggaccttcgggatatgaggaacacattagg
aatgtaataagagatgaattaagtacttttactgacaatatacttatagatagaatggga
aatattatagtgcataaggatagacaaaatgattcttcatctaaaataatggtgatttct
cacatagatgaatcaggtctcataataacagcttataataaagatggaacactaaaattt
tccacattaggggatatagataaaaattcacttcctgctaaggctgttttaattggagat
aaaaaaataccaggagttattggaatgaagccaatacatattcagagtaaaaaagaaaga
gatgaaaatatatcctatgaaaatatgtgtatagatataggcgctttttcccaagaggaa
tgtagaaggattatatcattaggggattttgtagtatttaataataaattttctcatttt
ggagataaccttttaaaaggaaaagctctagataatagagtaggatgttctatacttata
gagttattgaaggaagacttaaattgcaacttatatggtgtatttaatgttcagggaaat
atagaccaaagaggaattcatgcggttgcttacaatattgatccagatttagtcataatt
ttagataccataaatagtatagattatatggaaattcccagttatttcaggacaagtaaa
ttaagagaaggtcctgttataccttttaaaggtggacagtgtatattcgatagaggtatt
gtagaatctatccggaataaagcagatgacataggaataccatatcaaaaaattggagat
actcatggagaaggagaacttaaagcagcttatcttactgttaataattgtaaaactgca
tcgatattattaccatgtagatacatgaattttaatatttctatatgcagtttagctgat
tatgataatactttatttttattaaaaagctatttagaggactgtagtataaatatttag

DBGET integrated database retrieval system