KEGG   Clostridium kluyveri NBRC 12016: CKR_3378Help
Entry
CKR_3378          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K06187  
recombination protein RecR
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKR_3378
DNA repair and recombination proteins [BR:ckr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CKR_3378
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CKR_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3807900..3808496)
Genome map
AA seq 198 aa AA seqDB search
MDFYPVAIEKLIEEFAKLPGIGRKTAQRLTLHVLNLPADEVREFAKALVKARGTIKYCSI
CGNFTDSDPCAICSNPNRDKSIICVIEEPKDIMSMERIKEYNGVYHVLHGNISPMAGRGP
EDIKLRELIRRINGDVNEVIVATNPNVEGEATAMYISKILKHLGVKVTRIAHGIPVGGNL
EYADEVTLLKALEGRTEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatttttatcctgttgctatcgaaaagttaatagaagagtttgcaaaacttccagga
ataggacgtaaaacagcccaaagacttacattacatgtattaaatttacctgcagatgag
gtaagagaatttgctaaagctttagttaaggcaagaggtactataaagtattgttctatt
tgtggaaattttacagattctgatccctgtgccatatgttcaaatcctaatagagataaa
agtataatttgtgtaattgaagaacctaaagatataatgtctatggagagaataaaagaa
tataatggagtttaccatgtattacatggtaatatatcacctatggcaggaagaggacct
gaagatataaaacttagagaacttataagaagaataaatggtgatgtgaatgaggttata
gtagctactaatcccaatgtagagggagaggctacagctatgtatatatctaaaatactg
aaacaccttggagtaaaagttaccagaatagctcatggcattccagtaggaggaaattta
gaatatgcagatgaggttacactattgaaggcactggaaggtagaacagaaatataa

DBGET integrated database retrieval system