KEGG   Campylobacter lari: Cla_0088Help
Entry
Cla_0088          CDS       T00858                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cla  Campylobacter lari
Brite
Enzymes [BR:cla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cla_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(76057..76977)
Genome map
AA seq 306 aa AA seqDB search
MKTFIILIFSLLPLLALEMITPLPESIPYDKEKAILGKKLYMDTSLSKDKKVSCNTCHDI
TKFGVDNKTFSTGINGIIDEPFHTPTNFNAVFNLSQFWRGNAKDLQDQAKHPLLNPKEMG
LKDESEVIQIVKANPIYEKEFKKLYGEVNFENITHALAEFQKTLLTPNSPFDRYLKGEKN
AISEQAKRGYNAFLSNGCIACHQGQNIGGNMYQKMGVFVPYDNGTNWKGRYEITQDPHDQ
FVVKVPSLRNIAKTAPYFHDGSMPTLDACVQFMAYYQLGKFLEQNVVDDIVAFLNSLTGE
YHDPLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttattattttaatattttctttgctaccacttttagcacttgaaatgatt
acccctttgcctgaaagtattccttatgataaagaaaaggctatcttaggcaaaaaactt
tacatggatacaagtttatcaaaagacaaaaaagtatcttgcaatacttgtcatgatatt
acaaaatttggagtagataataaaactttttcaacaggtattaatggcataatagatgag
ccatttcatacacctacaaatttcaatgcggttttcaatctatctcaattttggagaggt
aacgcaaaagacttacaagatcaagccaaacatcctttgttaaatcctaaagaaatgggt
ttaaaagatgaaagtgaagtaatacaaattgtaaaagctaatccaatttatgaaaaagag
tttaaaaaactttatggagaagtcaactttgaaaacataacacacgctttagctgagttt
caaaaaaccttactaactccaaattccccttttgatcgctacttaaaaggtgaaaaaaat
gctataagtgaacaggcaaaaagaggttataacgcttttttatctaatggttgtatagcc
tgtcatcaaggtcaaaatataggtggcaatatgtatcaaaaaatgggggtatttgtacct
tatgataatggaacaaactggaaaggacgctatgagattacccaagatcctcatgatcag
tttgtagtaaaagtaccaagtcttagaaatatagctaaaactgcgccttattttcacgat
ggttctatgccaacacttgatgcttgcgtgcaatttatggcttattatcaacttggtaaa
tttttagaacaaaatgtggttgatgatatagttgcttttttaaattctttaacaggagaa
taccatgacccactcaaataa

DBGET integrated database retrieval system