KEGG   Campylobacter lari: Cla_0250Help
Entry
Cla_0250          CDS       T00858                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cla  Campylobacter lari
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cla_0250 (galU)
   00052 Galactose metabolism
    Cla_0250 (galU)
   00500 Starch and sucrose metabolism
    Cla_0250 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cla_0250 (galU)
Enzymes [BR:cla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cla_0250 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(221609..222433)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMETMGFVTGRGKR
ALEDYFDISYELEHQIAGTKKEYLLSEIRTLIDRCTFTFTRQNEMKGLGDAVLKAKPLVQ
DEAFGVILADDLCVNEDGVNVLAQMVKIYEKYRCSVIAVMEVEADQVSNYGVIAGNAVEE
DLIMVNSMVEKPDPKDAPSNLAIIGRYILTPDIFGILENTKAGKNGEIQLTDALLSQATN
NMVLAYKFKGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtatttttcctgcagcaggctatggtactagatttttacctgctaca
aaaaccctacctaaagaaatgctacctatactaactaaacctttaattcactatggtgta
gatgaggctttagaagctggtatggaaactatgggctttgttacagggcgtgggaaaaga
gctttggaggattattttgatatttcttatgagcttgagcatcaaattgcgggtactaaa
aaagaatatcttttaagtgaaataagaacactcatagatcgctgcacttttacttttaca
agacaaaatgaaatgaaaggcttgggagatgcagttttaaaagcaaaacctttagtgcaa
gatgaagcttttggggtaattttggcagatgatttatgtgtaaatgaagatggggtaaat
gttttagctcaaatggtaaaaatttatgaaaaataccgctgctctgttatagctgtaatg
gaagttgaagctgatcaagtctcaaactatggggttatagctggaaatgctgtagaagag
gatttaatcatggtaaattctatggtagaaaaacctgatccaaaagatgctccaagcaac
ttagccatcataggaagatacattctaacacctgatatttttggcattttagaaaatacc
aaagcaggtaaaaatggagaaattcaactaactgatgcattgctttcacaagcaactaac
aatatggttttagcttataaatttaaaggaaaaaggtttgattgtggaagcgtagaaggc
tttgtggaggcgacaaattatttttatgagaaaagtaaatgctaa

DBGET integrated database retrieval system