KEGG   Campylobacter lari: Cla_0256Help
Entry
Cla_0256          CDS       T00858                                 

Definition
phosphohexosemutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cla  Campylobacter lari
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cla_0256
   00030 Pentose phosphate pathway
    Cla_0256
   00051 Fructose and mannose metabolism
    Cla_0256
   00052 Galactose metabolism
    Cla_0256
   00500 Starch and sucrose metabolism
    Cla_0256
   00520 Amino sugar and nucleotide sugar metabolism
    Cla_0256
  Nucleotide metabolism
   00230 Purine metabolism
    Cla_0256
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cla_0256
Enzymes [BR:cla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Cla_0256
    5.4.2.8  phosphomannomutase
     Cla_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226455..227822
Genome map
AA seq 455 aa AA seqDB search
MLDLIFREYDIRGLYPSELNEKSVKAIGYALGLEMKTRGCEKVSIGYDARYSANELFNYL
ISGLNKANVQVFNIGLAPTPMGYFSLFFDDIFDANIMITGSHNPKEYNGFKITINKESFF
GADLKKLSLKVQEYLNLNIEDDLRYENYDIKSLYIEFLAKHFLHLKNYKEKIIIDCANGA
TGVIIKPLVEKLNLNAQILFENPDGNFPNHAPDPTEIENLHALQNALKKDESAKMGFAFD
GDGDRLVVASKDYIFKGDELCYLFAKNIKNPRVLGEVKCSKNLFDEVAKFGFIMMGKTGH
SNIKTMMKEHNIDLAAELSGHIFFKDRYFGYDDGIYAFLRTLELLAKNYDLKALVDELPK
LYASEEIKLKVSEENKFKIIEKLKEKVKANAFENVLECNEIDGVRIIFEDGWALLRASNT
SPYLIMRTEATSEQFKNFLELRVKELFEDIIKEFA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttagatttgatttttagagagtatgatataagagggctttacccaagtgagttaaat
gaaaaaagcgtaaaagctataggctatgctttgggtttagaaatgaagacaagaggttgt
gaaaaagtaagtataggttatgatgcaagatatagtgcaaatgagctttttaattattta
ataagtggtttaaataaggctaatgtacaagtttttaatataggcttagcaccaactcct
atggggtattttagtctattttttgatgatatttttgatgcaaatatcatgataacaggc
tcgcataatccaaaagaatacaacggctttaaaattacaattaacaaggagagttttttt
ggtgctgatttgaaaaaattatctttaaaagtgcaagagtatttaaatttaaacatcgaa
gatgatttaagatatgaaaattatgatattaaaagcttatatatagagtttttagctaaa
cattttttacatcttaaaaactataaagaaaaaatcattattgattgtgcaaatggtgct
actggagtgattataaagcctttggtggaaaaattaaatcttaatgcacaaattttattt
gaaaatcctgatggaaattttccaaatcacgcacccgatccaacagaaattgaaaattta
catgcccttcaaaatgctttaaaaaaagatgaaagtgccaagatgggttttgcttttgat
ggggatggggatcgtttggtggttgcaagtaaagattatatatttaaaggtgatgagctt
tgttatttatttgctaaaaatataaaaaatcctagagttttaggtgaggtaaaatgctct
aaaaatctttttgatgaggtggcaaaatttggttttatcatgatgggtaaaacggggcat
tcaaatataaaaacaatgatgaaagaacacaatatcgatttagcagcagagcttagtggg
catattttctttaaagatagatattttggttatgatgatggaatttatgcatttttaaga
accttagagcttttggcaaaaaattatgatcttaaagccttggttgatgaattgccaaag
ctttatgcaagtgaagagattaagcttaaagtgagtgaagaaaataaatttaaaatcata
gaaaaattaaaagaaaaagttaaagcaaatgcttttgaaaatgtgcttgagtgtaatgaa
attgatggggtaagaattatttttgaagatggctgggcacttttgcgtgcttctaataca
agcccttatcttatcatgcgcacagaagctacaagcgagcaatttaaaaactttttagaa
ttaagagtaaaagagctttttgaagatatcataaaagagtttgcataa

DBGET integrated database retrieval system