KEGG   Campylobacter lari RM2100: Cla_0415Help
Entry
Cla_0415          CDS       T00858                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cla  Campylobacter lari RM2100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cla_0415 (tpiA)
   01230 Biosynthesis of amino acids
    Cla_0415 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cla_0415 (tpiA)
   00051 Fructose and mannose metabolism
    Cla_0415 (tpiA)
   00562 Inositol phosphate metabolism
    Cla_0415 (tpiA)
Enzymes [BR:cla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cla_0415 (tpiA)
Exosome [BR:cla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cla_0415 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cla_0415 (tpiA)
  Exosomal proteins of melanoma cells
   Cla_0415 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(387614..388294)
Genome map
AA seq 226 aa AA seqDB search
MIFAANLKCNHTRSSFELYAQKLNQNLSNEDEIFIFPPSIAFSSLKVNFHQGAQNFYPCE
NGAYTGEIGKIHLEEFNIKSVLIGHSERRALNEDESFLKAKFDFAKNLDFNIIYCIGESL
ETKNANKSLDFLKKQIENIDLSYKKLIIAYEPIYSIGTGVSANLDDINTILNFLRKFTNA
KLLYGGSVNQSNIKEICALKNCDGVLIGSAALNASDFLNMIQIAKG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgcagcaaatttaaagtgtaatcatacaagatcaagctttgaactttacgct
caaaaattaaaccaaaacttaagcaatgaagatgaaattttcatcttcccaccaagcata
gctttttctagtttaaaagtaaattttcatcaaggagcacaaaatttttacccttgtgaa
aatggcgcatatactggagaaataggtaaaattcacttagaagaatttaatatcaaaagc
gtgctaataggtcattctgaaagacgagctttaaatgaagatgaaagctttttaaaggct
aaatttgattttgcaaaaaatcttgattttaatattatttattgtataggtgaaagttta
gaaactaaaaatgccaataaaagtttagattttttaaaaaaacaaattgaaaatattgat
ttatcttataaaaaactcattatagcttatgagcctatttattctataggcacaggagtg
agtgctaatcttgatgatattaataccatacttaattttttaagaaaatttactaatgct
aagcttttatatggtggaagtgttaatcaaagcaatattaaagaaatttgtgctttaaaa
aattgcgatggagtattgataggttcagctgcattaaatgcaagcgattttttaaatatg
atacaaatagctaaaggttaa

DBGET integrated database retrieval system