KEGG   Campylobacter lari: Cla_0633Help
Entry
Cla_0633          CDS       T00858                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cla  Campylobacter lari
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cla03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607683..608234
Genome map
AA seq 183 aa AA seqDB search
MIVAIEGIVSKKEPTFVVLKTSSGVSYGVYVSLFCSGNFEKDQKIELSITQIIKEDSHKL
YGFLDTNEQRMFELLIKISGIGATTAMALCSSLDTNTFYTALQSGDESVFKKVPGIGPKS
AKRIIAELSDAKINIENSNQDHAQALAALLSLGFKQENILKVLRTCESQNTSELIKEALK
KLA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtggcaattgaaggaatagtgagtaaaaaagaacctacttttgtagttttaaaa
acttcaagtggggtaagttatggtgtttatgtgtcgcttttttgctcaggtaattttgaa
aaagatcaaaaaattgagctttcaatcacacaaattatcaaagaagactctcataaatta
tatggatttttagataccaatgagcaaagaatgtttgaattattaattaaaattagtggt
ataggagcaactactgctatggcactttgctcaagtttagatactaatactttctataca
gctttacaaagtggcgatgagagtgtatttaaaaaggttcctggtattggcccaaagagt
gcaaaaagaattatagctgagttaagtgatgcaaaaatcaatatagaaaattctaatcaa
gaccatgcacaggctttggcggccttactttcacttggttttaaacaagaaaatatttta
aaagttttaagaacttgcgagagtcaaaatactagtgagcttattaaagaagctttgaaa
aaattagcataa

DBGET integrated database retrieval system