KEGG   Campylobacter lari: Cla_0683Help
Entry
Cla_0683          CDS       T00858                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cla  Campylobacter lari
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cla02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cla02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653716..654267
Genome map
AA seq 183 aa AA seqDB search
MKLVLIGSSTGGPSQLKFLLNDVELKDCAVVIAQHMNPAFIPSFVNQFNKEAKSDVVIPN
DKEVLKNKIYICQRNMVLGGNNTLTLNTTEQTSSFNPGIDVLFHSAVNLYKYHKILALIM
TGMGDDGAKSLFDLYKVGVRCLCENEADSIVYGMPKKARDTNPNLKPMSLIELKKEIINF
IKS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgttttgattggttcttcaacgggtggtccaagtcaactaaagtttttacta
aatgatgtagaacttaaagattgcgcggtagtgattgctcaacatatgaatccagctttt
atcccttcttttgtgaatcaatttaacaaagaagcaaaaagcgatgttgtcataccaaat
gataaagaagttttaaaaaataaaatttacatttgtcaaagaaatatggttttaggtgga
aataatacactaacactaaatactacagaacaaacaagtagttttaatccagggatagat
gttttattccattcggctgtaaatctttacaaataccataaaattttagccttgattatg
acaggaatgggtgatgatggcgctaaatctttgtttgatctttataaggttggagtaagg
tgtttgtgcgaaaatgaagcagattctatagtatatgggatgccaaaaaaagccagggat
actaacccaaatttaaaacctatgagtttaatagaactcaaaaaagaaataataaatttt
atcaaatcatag

DBGET integrated database retrieval system