KEGG   Campylobacter lari: Cla_0736Help
Entry
Cla_0736          CDS       T00858                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cla  Campylobacter lari
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cla00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cla00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703738..704994
Genome map
AA seq 418 aa AA seqDB search
MTYLEIDGVEKLSGEVIISGAKNAALPLIASSILAKNEAQISNLPNVADICTLLSLLKNL
GASYTFENNFAKINTKDLNKTIAKYDIVRKMRASILTLGPLLARFGNCEVSLPGGCAIGQ
RPIDLHLLALEKMGANIEIKQGYVVASGKLKGADLMFDKITVTGSENIIMAAALAHGKTR
LLNVAKEPEVVQLCEVLAEAGLDIKGVGSDELEIYGTSGELLEFKPFKIIPDRIEAGTYL
CAGAITNSKITLKNVNANHLGAVLAKLEQMGFSFDISEDSISINPAKEIKPVEILTSEYP
GFPTDMQAQFMALALRANGVSIIDERLFENRFMHVSELLRMGADIRLNGHIATINGTKEL
FGADVMATDLRASSALILAALAAKGTSKIHRIYHLDRGYENLEEKFKNLGASIRRLEE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacttatttagagattgatggtgttgaaaaattaagcggagaagtgataataagtggt
gcaaaaaatgctgcacttcctttgatagcttcaagtattttagctaaaaatgaagctcaa
atttcaaatttacctaatgttgcagatatttgcaccctactttctttgcttaaaaattta
ggagcaagttatacttttgagaataattttgcaaaaataaacactaaagatttaaataaa
accatagcaaaatacgacattgttcgcaaaatgcgcgcttctatacttacactagggcct
ttattagctagatttggaaattgtgaagtatctttaccagggggttgtgctataggccaa
cgtcctattgatttacaccttttagctttagaaaaaatgggagcaaatattgaaataaaa
caaggttatgtggtagctagtggaaaactcaaaggtgctgatttgatgtttgataaaatc
accgttacaggcagtgaaaatatcatcatggcagcagccttagctcatggtaaaacaaga
cttttaaatgtcgctaaagaacctgaagtggttcaactttgcgaggttttagctgaggct
gggcttgatataaaaggtgtgggaagtgatgagcttgaaatttatggtacaagcggagag
cttttagagtttaaaccttttaaaatcattcctgatcgcattgaagcaggaacttacttg
tgtgcaggtgctattacaaattcaaaaattactttaaaaaatgttaatgcaaaccatctt
ggagcggttttagcaaaattagagcaaatgggttttagctttgatataagtgaagatagt
attagtataaaccctgctaaagaaatcaaaccagttgaaattttaactagtgagtatcca
ggttttccaacagatatgcaagcgcaatttatggctttggctttaagagcaaatggagtt
agcattatagatgagagattgtttgaaaatcgcttcatgcatgtaagtgagcttttaaga
atgggtgctgatataagattaaatgggcatattgctactataaatggcacaaaagagctt
tttggagctgatgttatggctactgatttgcgtgcatcttcagctttgattttagcagct
ttagcagctaagggaacgagtaaaattcatagaatttatcatctcgatagaggatatgaa
aatttggaagaaaaatttaaaaatttaggtgcgagcataagaaggcttgaagaatga

DBGET integrated database retrieval system