KEGG   Campylobacter lari: Cla_0783Help
Entry
Cla_0783          CDS       T00858                                 

Gene name
tpx
Definition
thiol peroxidase (EC:1.11.1.-)
Orthology
K11065  
thiol peroxidase, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
cla  Campylobacter lari
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745208..745732
Genome map
AA seq 174 aa AA seqDB search
MNSVLFKGNKVNLKGNNIQVGDMAPNITLKAKDLSGVEIAPKGKTQIIISVPSLDTPVCA
TEAREFNKKAAASGVEVIVVSMDLPFAMGRFCSTEGIDNLTVASDFVSKEFGEKYGVLMA
DGPLEGILARAVFVVKDGVVAYKELVNEVTELPNMQALESFFGQSCGCGGCGCH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgtattattcaaaggaaataaagtaaatttaaaaggaaataacatccaagtt
ggcgatatggctccaaatatcaccttaaaagctaaagatctttcaggtgttgaaattgct
ccaaaaggtaaaactcaaattattatcagcgtaccaagccttgatactccagtatgtgca
acagaagctagagaatttaataaaaaagcagcagcaagtggtgtagaagtaatcgtagtt
agtatggacttaccatttgctatgggtcgtttttgttcaactgaaggtatagataattta
actgtagcaagtgattttgtttctaaagaatttggtgaaaagtatggtgttttaatggct
gatggtccacttgagggaattttagctagagcagtgtttgtagttaaagatggtgtggtt
gcttataaagaattagtaaatgaagtaacagaacttccaaatatgcaagctttagaaagc
ttctttggtcaaagttgtggatgtggtggttgtggttgccactaa

DBGET integrated database retrieval system