KEGG   Campylobacter lari RM2100: Cla_0902Help
Entry
Cla_0902          CDS       T00858                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cla  Campylobacter lari RM2100
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cla_0902 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cla_0902 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cla_0902 (thrC)
Enzymes [BR:cla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cla_0902 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860403..861812
Genome map
AA seq 469 aa AA seqDB search
MLLHSTQDKNHQVSFSKALLSPSAPNNALYAPLNLPKLDNEALKNLNYKELALKIIAAFD
FDLKLEVFEKALKTYENFDDKTCPINLRKINNKLYINELFHGPTRAFKDMALQPFGVLLE
YLKKDDDFLIMCATSGDTGPATLKSFENKKGIKVVCIYPNEGTSKTQALQMTHSNASNLK
SIAIEGNFDDAQNALKTLLNDEDFKNTLKEEKLSLSAANSVNFGRILFQIIYHYYASLKI
DRTIDIIIPSGNFGDALGAYYAKKMGANIGKIKIASNSNNILSEFFNTGKYDLRNKSLQK
TISPAMDILISSNIERLLFDKFKDERTKELMQALKNEKYYELSQKELELLQEDFEADFCN
DDECMQYIKQYSHLGLLDPHTCTCFKMLDSNTTTLITSTAQWSKFTPSMYQAIYNKECQD
EQVCMQELAKEFKQEIHPNIASLFTSTQKQNQVCKLENLKQTIIEWIKQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttactacactcaacccaagataaaaatcaccaagtaagcttttcaaaggccttactt
agccctagtgcacctaataatgctttatatgcaccacttaatctaccaaagcttgataat
gaagctttaaaaaatttaaactacaaagaattagctttaaaaattatcgcagcttttgat
tttgatttgaaacttgaagtttttgaaaaagctttgaaaacttatgagaattttgatgat
aaaacctgccctattaatttaagaaaaattaataataagctttatattaatgaattattc
catgggccaacaagagcttttaaagatatggctttacagccttttggcgtgcttttagaa
tacttaaaaaaagatgatgattttttaatcatgtgcgctacaagtggtgatacagggcct
gctacactaaaaagctttgaaaataaaaaaggtataaaagtagtttgtatttacccaaat
gaaggtacaagtaaaactcaagctttacaaatgacgcattcaaatgcaagcaatttaaaa
tccatagccattgaaggtaattttgatgatgcacaaaatgccctaaaaacacttttaaat
gatgaagattttaaaaatactttaaaagaagaaaagttaagtctaagtgctgcaaattcg
gttaattttggaagaatactttttcaaatcatctatcattactatgctagtttaaaaatc
gatagaacaatagatatcatcattccaagtggaaattttggcgatgctttgggagcttat
tatgctaaaaaaatgggagcaaatataggtaaaattaaaattgcttccaattcaaacaat
atcttaagtgagttttttaatacaggcaaatatgatttaagaaataaaagcttacaaaag
actatttctcctgctatggatatactcatatcatcaaatatagaaagattgctttttgat
aaatttaaagatgaacgcaccaaagaacttatgcaagctttaaagaatgaaaaatattat
gagcttagccaaaaagaactagagcttttacaagaagactttgaagctgatttttgcaat
gatgatgagtgtatgcaatatatcaaacaatacagccacttagggcttttagatcctcac
acttgcacttgctttaaaatgcttgattctaacaccacgacactcatcacttccacagca
caatggagtaaatttaccccaagcatgtatcaagcaatttataacaaagaatgccaagat
gaacaagtttgcatgcaagaacttgcaaaagaatttaagcaagaaattcatccaaatatt
gcaagcttatttacaagcactcaaaaacaaaatcaagtttgcaaacttgaaaatctaaaa
caaactattatagaatggataaaacaatga

DBGET integrated database retrieval system