KEGG   Campylobacter lari: Cla_0926Help
Entry
Cla_0926          CDS       T00858                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cla  Campylobacter lari
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cla_0926
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cla_0926
Enzymes [BR:cla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cla_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888526..889128
Genome map
AA seq 200 aa AA seqDB search
MFKTIDLKNHFSKTQKILESKKEIFPYDMLGRSLASNAFYPKDIYTLLHERKLSHFLYSK
DLNFNHENFDAIILPTSPLLNQDIQNLSLFRRYHEKPIVQFDFIFDEYQILESLVYGADA
FIVFPKMLKTKQLKKLYNFAIHLGLEAIFYLESKSDLNNAILAGARIFLLEDEKLLSLIP
KNKALISKNIKNLHACIKES
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacaatagatttaaaaaatcatttttcaaaaacacaaaaaattctggaaagt
aaaaaagaaatttttccttatgatatgctaggtagaagcctagcttccaatgccttttat
cctaaagatatttatacacttttacatgaaagaaaactttcacattttttatattctaaa
gatttaaattttaatcatgaaaattttgatgccatcatcttaccaacaagccctttgctt
aatcaagacatacaaaatttaagtctttttagacgctaccatgaaaaacctattgtgcaa
tttgattttatttttgatgaatatcaaattttagaaagcttagtatatggggctgatgcg
tttattgtatttcctaaaatgctaaaaactaagcaactaaaaaaactttataattttgca
atacatcttggtttagaagccattttttaccttgaaagcaaaagtgatcttaataacgct
attttagcaggagctagaatttttttattggaagatgaaaagctattatctttgatacca
aaaaataaagctcttataagtaaaaatatcaaaaatttacatgcttgcataaaggagagt
tga

DBGET integrated database retrieval system