KEGG   Campylobacter lari RM2100: Cla_1059Help
Entry
Cla_1059          CDS       T00858                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cla  Campylobacter lari RM2100
Pathway
cla00900  Terpenoid backbone biosynthesis
cla01100  Metabolic pathways
cla01110  Biosynthesis of secondary metabolites
cla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cla_1059 (ispE)
Enzymes [BR:cla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cla_1059 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N PP-binding
Motif
Other DBs
NCBI-ProteinID: ACM64381
UniProt: B9KCU2
Position
1015232..1015987
Genome map
AA seq 251 aa AA seqDB search
MKAYAKANIFLKIIGIDSRSYHLLQSRFVLLKDIFDELSFSGEKFKEGFEITGNFTQDTI
IHKAYKELEILGFSNELNEFFKDKSLKLIKNIPIGGGLGGSSTDAVTFLLMINEALNLKL
NQQQLKQICQKLGSDLIFFLSGYDSANVSGCGEVVEYFEDDFTQLDFTFPAIECSSAKVY
KAFDERSYDLTANLNLAKTLKTLKTSEILEYKNTDLNDLFAPCVKIYPKMQTFLNEAYFL
SGSGSGVFKAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttacgcaaaagctaatatttttttaaaaatcataggaattgattcaagatca
tatcatttattgcaatcacgctttgttttactaaaagatatttttgatgagttaagtttt
agtggtgaaaaattcaaagaagggtttgaaatcaccggaaattttacccaagataccatc
atacacaaagcttataaagaattagaaattttaggattttctaatgaattaaatgaattt
tttaaagataaaagtttaaagcttatcaaaaacattcccataggtggaggccttggtgga
agtagcactgatgcggtgacatttttgcttatgatcaacgaagctttaaatttaaaactc
aaccaacaacaacttaaacaaatctgccaaaaactcggttctgatttaatctttttttta
agcggatatgatagtgcaaatgttagcgggtgcggcgaggttgtagaatattttgaagat
gattttacccaacttgattttacttttccagctattgaatgttcaagtgcaaaagtatat
aaagcatttgatgaaagatcatatgatttaacagcgaatttaaatttagccaaaacactt
aaaacactcaaaacaagtgaaattttagagtataaaaatactgatttaaatgacttattt
gctccttgtgtaaaaatttatcctaaaatgcaaacttttcttaatgaggcttatttttta
agtggaagtggaagtggagtttttaaggctaaatga

DBGET integrated database retrieval system