KEGG   Campylobacter lari: Cla_1288Help
Entry
Cla_1288          CDS       T00858                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cla  Campylobacter lari
Brite
Enzymes [BR:cla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Cla_1288
Secretion system [BR:cla02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Cla_1288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241459..1242172
Genome map
AA seq 237 aa AA seqDB search
MKKSLALLTLASSLFAASNEEIINFFKKNPNLSNANISVSSREKIPDANFEAVIVNFEIG
GKNFQEIVFTQDNIITTEVIDVKKGEFYSQVYQAKLMEKQQAEFSKKALVELKKEKMFIS
LGDKNKPLLYVFSDPECPYCRIHLDKIEETLKTHQVKFILTPIHDTSAFEKSALIYKESK
NAKDDAQKIAIMKKYYDKDIKDYKKPSEAEVKAVRETFAKYSKLGLRAVPTIIDAQK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctttagctcttttaactcttgctagttctttatttgctgcaagtaatgaa
gaaattattaatttttttaagaaaaatccaaatttatcaaatgcaaatattagtgtttct
agtagagaaaaaattcctgatgctaactttgaagctgtgatagttaattttgaaattggt
ggtaaaaatttccaagaaatcgttttcactcaagataatatcatcacaaccgaagtaatt
gatgtgaaaaagggtgagttttattctcaagtttatcaagcaaaactgatggaaaaacaa
caagctgaattttcaaaaaaagctctagtggaacttaaaaaagaaaaaatgtttatttct
ttaggtgataaaaacaaacctttactttatgtttttagcgaccctgaatgtccatattgt
agaatacatttagataaaatagaagaaacactaaaaactcatcaggttaaatttatctta
actccaatccatgatacaagcgcatttgaaaaatctgcattaatctacaaagaaagcaaa
aacgctaaagatgatgcgcaaaaaattgctatcatgaaaaaatactatgataaagatata
aaagattataaaaagcctagtgaagctgaagttaaagcagtaagagaaacttttgcaaaa
tactctaaacttggtcttcgtgctgtaccaaccataatcgatgcccaaaaataa

DBGET integrated database retrieval system