KEGG   Campylobacter lari RM2100: Cla_1345Help
Entry
Cla_1345          CDS       T00858                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cla  Campylobacter lari RM2100
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cla_1345 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cla_1345 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cla_1345 (trpB)
Enzymes [BR:cla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cla_1345 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1292602..1293777
Genome map
AA seq 391 aa AA seqDB search
MKKYYGKFGGQFVPNEVKIALDEVEKAFLKLKKDKDFNAELKELLANYIGRPTPLYHAKN
LSKLYNHEIYLKREDLTHTGAHKINNAIAQALMAKKMNKKKIIAETGAGQHGLATATAAA
LLGLECEIFMGAIDVKRQALNVYKMELLGAKVHAVESGSKTLSDAVDEALKFWVKNTKEV
FYVVGSAVGPYPYPQIVTHFQSIIGKECKIQLRKLNKKVDYIIAAAGGGSNAAGIFHAFL
KDEKVKLIGVEAAGLGKDTPYHAATLTKGKEGIIHGMKTKVLQDNKGNIAHTFSISAGLD
YPGIGPLHAYLQESKRASYHAISDDECINALKLLCKEEGIIPAIESSHALAYLEKLCPTL
KKKSVIVVNLSGRGDKDMQSIYEYKRGEIYG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattatggaaaatttggtgggcaatttgtgccaaatgaagtaaaaatagca
ctagatgaagtagaaaaagcttttttaaaactcaaaaaagataaagattttaacgcagaa
ttaaaagaactcttagctaattatataggaagacccacacccttataccatgctaaaaat
ttaagcaagctttataatcatgaaatttatttaaaaagagaagatttaactcacacagga
gctcataagatcaataatgccatagctcaagccttaatggcaaagaaaatgaataagaaa
aaaattatcgcagaaactggagcaggacaacacgggcttgcaacagctaccgcagcagcc
cttttaggacttgaatgtgagatatttatgggagctattgatgtaaaaagacaagcctta
aatgtctataaaatggagcttttaggggcaaaagttcatgcagtagaaagtggaagtaaa
actttaagcgatgcagtagatgaggctttaaagttttgggttaaaaataccaaagaagta
ttttatgtagtaggaagtgcagtggggccttatccttatccacaaattgttacgcatttt
caaagcattataggtaaagaatgcaaaatacaacttagaaaattaaacaaaaaagtagat
tacatcatagcagcagctggaggtggtagcaatgctgctggaatttttcatgcattttta
aaagatgaaaaagttaagctcataggtgttgaagcagcaggtttaggaaaagatacacct
tatcatgcagccacacttactaaaggtaaagagggtattatccatggtatgaaaactaag
gttttacaagataataaaggaaacattgctcatacttttagtatctctgctgggcttgat
taccccggcataggtcctttgcacgcatatttacaagaaagcaaaagagcaagttatcat
gctattagcgatgatgagtgtattaatgctttaaaattattatgtaaagaagaaggtatt
atacccgctattgaaagctcacatgcattagcttatttagaaaaactttgtccgacttta
aagaaaaaaagtgtgatagttgtaaatctttcaggaaggggtgataaagatatgcaaagt
atttatgaatacaaaagaggtgaaatttatggttag

DBGET integrated database retrieval system