KEGG   Campylobacter lari: Cla_1481Help
Entry
Cla_1481          CDS       T00858                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cla  Campylobacter lari
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425603..1426175
Genome map
AA seq 190 aa AA seqDB search
MQEKFEQSVKNMLEIIGENPQREGLLKTPTRVFKAFEFLNSGYKQDPKQILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPDKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAEALMEHVGAKGVGVVIEARHMCVEMRGVQKANSTTSTSALRGSFLKSEKTRKEFFT
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaatttgaacaatcagtaaaaaatatgttagagattatcggggaaaatcca
caaagagaagggcttttaaaaactcctactagagtttttaaggcttttgaatttttaaat
agtggttataaacaagatccaaaacaaatactaaatgatgccttatttgaaagttcaaac
aatgaaatggttttagtaagagatatagaattttatagtctttgtgagcatcatctttta
cctttttttgggcgcgtgcatgttgcgtatataccagataaaaaagtcgtaggacttagt
aaaatcccacgtcttgtagaagtttttgcaagacgcttacaaattcaagaacaactcaca
gaacaaatcgcagaagcattaatggaacatgtaggtgcaaaaggtgttggggtggttatt
gaagcaagacatatgtgtgttgaaatgcgtggggtgcaaaaggcaaattctactactagc
acttcagcactaaggggtagctttttaaaaagtgaaaaaacaagaaaagaattttttacc
ttaattaactcagcaaaacaggttagattttaa

DBGET integrated database retrieval system