KEGG   Campylobacter lari RM2100: Cla_1535Help
Entry
Cla_1535          CDS       T00858                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cla  Campylobacter lari RM2100
Pathway
cla00900  Terpenoid backbone biosynthesis
cla01100  Metabolic pathways
cla01110  Biosynthesis of secondary metabolites
cla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cla00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cla_1535 (dxr)
Enzymes [BR:cla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cla_1535 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ACM64838
UniProt: B9KE50
Position
complement(1489489..1490568)
Genome map
AA seq 359 aa AA seqDB search
MIVLGSTGSIGVNTLFIAKEKNISIEALSCGKNIKLLNEQIALFKPKFVCIQDEKDKHLV
DHKNIFCAQDGLKKMISECKSKFVVNAIVGFAGLNSSLIAQKLGKTLALANKESLVVAGK
FFDTSKIKAIDSEHAALKCLIDKRKDIKKLFITASGGAFYKYKIKDLKNVSVKEALKHPN
WSMGAKITIDSASMCNKLFEIIEAYHLYGIKQIDAVIEKKSLVHALCEFKDGGISAYFSH
ANMRLSIAQAILDEHDQSFIENLDLLAMPSLKFEKISLKKYPIFMLKDELLKNPDLGVVI
NAANEYLVYKFLKNQMGFLDISKGIFKALDHFGVPKINQIEDVFEYDKRVRLYLDKEMK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttcttggaagtacaggaagtataggggttaatactctttttatcgctaaagaa
aaaaacataagcatagaagctttatcttgtggaaaaaatataaaacttttaaatgagcaa
atagctctttttaagcctaaatttgtatgtattcaagatgagaaagataagcatttagtt
gatcataaaaatattttttgcgctcaagatggcttaaaaaaaatgattagtgaatgcaaa
agcaaatttgtagtaaatgctatagttggttttgcaggattaaactcaagtcttatagca
caaaaacttggtaaaactttagccctagcaaataaagaaagtctagtagtagcagggaaa
ttttttgatacttctaagattaaagccatagatagcgaacacgcagcactaaagtgcttg
atagataaaagaaaagatattaaaaaacttttcataacagcaagtggtggtgctttttat
aaatataaaatcaaagatttaaaaaatgtcagcgtaaaagaggctttgaagcatcctaac
tggagcatgggtgctaagatcactatagatagtgctagtatgtgcaataagctttttgaa
atcatcgaagcttatcatctttatggtattaaacaaattgatgctgtgatagaaaaaaaa
tctttagtgcatgctttgtgtgaatttaaagacggtgggataagtgcttatttttctcat
gcaaatatgcgtttatctatagctcaagcgattttagatgagcatgatcaaagttttata
gaaaatttggatttattagctatgccaagtttaaaatttgaaaaaattagtttaaaaaaa
tatcctatatttatgctaaaagatgaacttttgaaaaatcctgatttaggggttgtaata
aatgctgcaaatgagtatttagtttataaatttttaaaaaatcaaatggggtttttagat
atttcaaaagggatttttaaagcattagatcattttggagtgccaaagattaaccaaatt
gaagatgtttttgagtatgataagcgagtaaggctttatttagataaggaaatgaagtga

DBGET integrated database retrieval system