KEGG   Clostridium sp. BNL1100: Clo1100_0061Help
Entry
Clo1100_0061      CDS       T01708                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
clb  Clostridium sp. BNL1100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66047..68275)
Genome map
AA seq 742 aa AA seqDB search
MRKNLVQAATNIINGECKDPHSYLGMHLLGVEGKNLQTVVRVYQPTAKMVELLDVSAGNS
FPMKKLCSNGIYEITFPDRSDIFEYQLKITDLSGNSFSTHDPYCFWPVISEFDTHLFNQG
NHHRIYEKLGAHVMTHNKVKGTLFAVWAPCAKRVSVVGDFNQWDGRRHQMRELGSSGVWE
LFIPLVSTGDLYKYEIKTPEDNLIFKADPFAYYAEKRPDTASIVMDIDNYTWYDDQWMSA
REEKDVFNGPMSIYELHLGTWSTAAEPDENGDIYVNYRIIADRLIPYIKFMGYTHIELLP
VAEHPFDGSWGYQVTGYYAVTSRYGKPEDFMYFVDMCHQNDIGVFLDWVPAHFPKDAHGL
ARFDGTALYEHSDPRQGEHPEWGTLVFNHGRNEVRNFLISNAVFWFEKYHIDGLRVDAVA
SMIYLDYAKKPGQWIPNKYGGNLNLEAADFLKQLNTTVFGYFKGIIMVAEESSSWPMITK
PPYMGGLGFTFKWNMGWMNDFLKYIKMDPIYRKYHHNLITFSLMYAFSENYILVLSHDEV
VHGKCSMLSKQPGDYWQKFAGLRATYGYTYGHPGKKLLFMGGEYGQFIEWNDKKGLDWHL
LDYDMHKKLQTYVRDLNTLYRESKALYEVDLSYDGFEWIDCNDNDHSVVSFIRKGRDYHD
MLIFVCNFTPAVNYNYCIGVPFELEYELVMNSNYEKYGGYEPNDSNKIYTVINESLHGRP
FKLCLTIPPFGVLVLRPIFKDS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatttggttcaagcagctacaaatattataaatggtgaatgtaaagatcct
cattcataccttgggatgcaccttttgggtgtagaaggtaagaatcttcaaaccgttgtc
agagtttatcagcctaccgctaaaatggttgagcttttggatgtttccgcaggcaactcg
tttccaatgaaaaaactttgcagtaatggaatatatgaaataacatttccggacaggagt
gatatttttgaatatcagctcaaaataacagacctttcgggaaatagcttctcaacacat
gatccctattgtttctggcctgttatatccgaatttgacacacatctctttaatcaaggc
aatcaccacaggatttatgagaagctaggtgcacatgtgatgactcataataaggtaaaa
ggaaccctttttgcagtatgggctccttgtgccaagcgtgtgagtgttgtgggagatttc
aatcagtgggatgggcgcagacaccaaatgcgtgaactgggttcatcaggtgtctgggag
ttatttattcctcttgtatcaaccggagatttgtataaatatgagattaagacccctgaa
gacaatctgatttttaaagccgatccttttgcttattacgctgaaaagaggcctgataca
gcctcaattgttatggacatagataactacacttggtatgatgaccaatggatgagtgcc
agagaagaaaaagatgtattcaatggtccaatgtcaatatatgaacttcatctgggaaca
tggtcaactgccgcagaacctgatgaaaacggggacatatacgtcaattacagaattatt
gccgatagactgatcccgtatataaaatttatgggatatacgcacattgaactattgcct
gttgccgaacatccctttgacggttcctggggatatcaggttacgggctattatgctgtc
acaagccgttatggaaaacctgaagatttcatgtattttgttgacatgtgccatcagaat
gatataggagtctttttggactgggttccagctcatttccctaaagatgcccatgggttg
gcccggtttgacggaacagccttatacgagcattcagacccacgtcagggagaacatcct
gaatggggtactcttgtttttaaccatggacggaatgaggtacgaaatttcctgatatca
aatgctgtattctggtttgaaaaataccatatagacggtttaagagtagatgccgttgca
tctatgatttacctggactatgctaaaaaacccggacagtggattccaaacaaatacggt
ggaaatctcaatcttgaggctgctgattttcttaaacagcttaataccactgtgttcggt
tattttaaaggtataataatggtagctgaggaatcctcctcatggcctatgattaccaaa
cctccttatatgggcggtctgggatttacctttaagtggaatatgggctggatgaatgat
ttcctgaagtatataaaaatggaccccatatacagaaaataccaccacaatcttataact
ttttcattgatgtacgctttcagtgaaaattatattcttgttctgtctcacgacgaagtt
gtacacggcaaatgctccatgctaagcaaacagccgggagattactggcaaaagtttgca
gggctccgggccacctatggttacacctatggtcacccgggaaaaaagcttctgtttatg
gggggcgaatacgggcaattcatcgagtggaacgacaaaaaaggtttagattggcacctt
ctggattatgatatgcataaaaagctgcaaacctatgtcagggatttgaatactttgtat
agagaaagcaaggctttatatgaagtggatttaagctatgacgggtttgagtggatagac
tgcaatgataacgaccacagtgttgtttcctttataagaaagggccgggactaccacgat
atgctgatatttgtttgcaattttacacccgcagttaattataattattgcatcggtgta
ccttttgaacttgaatatgagcttgttatgaacagtaactatgaaaagtatggcgggtat
gaaccgaatgattcaaataaaatatatacggtgattaacgaatctttgcatggaaggccc
tttaagctttgtcttacaatacccccattcggcgtacttgttttgagacctatattcaaa
gactcctga

DBGET integrated database retrieval system