KEGG   Clostridium sp. BNL1100: Clo1100_0085Help
Entry
Clo1100_0085      CDS       T01708                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clb  Clostridium sp. BNL1100
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clo1100_0085
Enzymes [BR:clb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clo1100_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
88073..90472
Genome map
AA seq 799 aa AA seqDB search
MATGQFQQQRWSFDSYPVGATLSIIGRFDYKIYENADNGYKIYTFDIERIVDEDGFEHEA
QDLISVTGYYEVNDHCAVLPCKIVGTVGVYKGEKQLKADIVEFIEPATDEGIITFLSCGI
IKGVGEKTARNIVVGYKTASGFIEGFGSNTLEIIKNEPLSLVKIKGISADKARLIHDSYM
ENMEYQNVMIFFQKFGVSSAKAMKIYNTFKGTSITIAEQNPYMFTNIKGFGFRTCDEIAK
KLGIDSHSIFRMEAALKSVLEAAETEGHCYLYRQQLLQATSKALSDNVDKISEDELEEAY
KRMIKTGLLVNITYTENEDRYEAVYTREMQKLEYETALAIKNIVRCQPEVSVVHVDKLIE
EFEELKGFELEAMQKESVRAVFETNMLILTGSAGSGKTTTVECMIYVLQRVFENREEMSF
MLAAPTGKAAKRLTEITGFEAMTIHRLLQFSYENKGFFYRQGNELPYDLIVIDESSMLSI
DLAHALFTAISPGTTVVMIGDTQQLPSVGAGNVLDDMIKSGVIPTVKLNVIKRQADGSGI
ISNANRIINGEMPEIINQNKDFFVIEEDDKYRVVKKTQEALNRLMTAYNHTIDDIQIICP
QKSSEIGTYELNKAIQEMVNPAEENKQEIKRGNSVFREGDKVIHLSNNYETPHYQRDPET
GRYFAEENCGIFNGDIGRIIEISNIKEIESEDEDASTPEKKVAVQYDDFIIIYHVNELEE
IDLAYCLTVHKMQGSQCEAAIILCHMRNYVMLNRNLGYTAVTRAKKMACIIGQKKAIKLM
VSNVKINERNSMLCDLLKL
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacaggacaatttcaacagcaaagatggtcatttgacagttaccctgtgggggca
acgctaagcattattggccggtttgactataaaatatatgaaaatgcagacaatggctat
aaaatctatacttttgatatagaaagaattgttgatgaggatggatttgagcatgaagcc
caggaccttataagtgtaacaggatattatgaggtgaatgaccattgtgcggttctaccc
tgtaaaattgtcggtaccgtaggagtatacaaaggtgaaaaacagcttaaggctgatatt
gtagaatttattgaacctgctacggatgaaggaataataacctttctatcatgtggaata
atcaagggcgtgggagaaaaaaccgcaagaaatattgttgtcggctacaaaacagcttca
ggtttcatcgagggctttgggagcaacacgttggagattataaagaacgaaccactttct
cttgtgaaaataaaaggtatatctgctgataaagcgaggcttatccacgattcctatatg
gaaaacatggagtatcagaacgttatgattttctttcaaaaatttggggtatcatcagct
aaggcaatgaagatctacaatactttcaaaggaacctccataactattgccgagcagaac
ccatatatgtttacgaatataaaaggctttgggtttagaacctgtgatgaaatagcaaaa
aaactgggaatagattctcactctatattcagaatggaagccgcccttaaaagcgtattg
gaagcagctgaaacagaaggacattgctacttatacagacaacagcttttacaggcaact
tcaaaagctttaagtgataatgttgataaaatcagcgaggatgaactggaagaagcctat
aagagaatgataaaaacgggacttcttgtgaatataacatatacagaaaatgaagataga
tatgaagctgtttatacaagggaaatgcaaaaacttgaatacgagactgcacttgccatt
aaaaatatagtgaggtgtcagcctgaagttagcgtggtacatgtggacaagttgatagag
gagtttgaagagctgaaaggctttgaacttgaagccatgcaaaaggaatctgttagagct
gtttttgaaacaaacatgctgattctcaccggttctgccggaagtggaaaaactactact
gtagaatgtatgatatatgtgttgcaaagagtttttgagaaccgtgaggaaatgagtttt
atgctggcagcaccaacaggaaaggctgctaaaagacttacagaaataacgggttttgaa
gcaatgaccatacaccggcttcttcaattttcctacgaaaataagggctttttttacaga
caaggcaacgaacttccatatgacctaattgtaatcgatgaaagctcaatgcttagtata
gacctggcccatgcattgtttactgctatttcacctgggacaaccgtagttatgattggt
gatacgcaacagctcccatcggtaggtgcgggaaatgtgcttgatgatatgataaaaagt
ggagttatacctacggttaagttaaatgttataaagcgtcaagcagacgggtccggcatt
atttcaaatgccaacagaattataaatggcgaaatgcctgaaataatcaatcaaaacaag
gatttctttgtaattgaagaagatgacaaatacagggttgtaaagaagactcaggaagca
ttaaacaggcttatgacagcctataaccacacaatagatgatattcaaataatttgcccg
caaaaatcttctgaaatcgggacgtatgaattaaacaaagcaatacaggagatggttaat
cctgcagaagaaaataaacaggaaataaaaagaggaaatagtgttttcagagaaggagac
aaggttattcacctaagcaataattacgagactcctcattatcagagagaccccgaaacc
ggaagatattttgctgaagagaactgtggcatttttaacggcgatatagggaggattatt
gaaatatccaatatcaaagaaattgaatcagaggatgaggatgcaagcacacctgaaaag
aaggtagcggttcagtatgatgattttataataatttatcatgtaaatgaacttgaggag
atagatctggcatattgcctgacagttcataaaatgcaggggtcccaatgcgaagctgca
attatactatgtcatatgagaaactatgttatgctgaacagaaatcttggatatacagct
gttacaagagccaaaaaaatggcgtgtattataggacaaaagaaggcaataaaattaatg
gtttcaaatgttaaaattaatgaaagaaattcaatgctctgcgaccttttaaagttatga

DBGET integrated database retrieval system