KEGG   Clostridium sp. BNL1100: Clo1100_0117Help
Entry
Clo1100_0117      CDS       T01708                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:clb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:clb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(117721..118260)
Genome map
AA seq 179 aa AA seqDB search
MTIYDFKVKDAQKNEISMDSYRGKVLLIVNTATGCGFTPQYEALENLYRTYKDKGLEILD
FPCNQFLNQAPGTEEEIVEFCQLKYGVSFKTFSKIDVNGSNADPLYTFLKKATPADKENQ
ETSSFMKVLKDLGQSIVGSNIKWNFTKILIDRNGNVVGRYSPTYKPENMEAKIQELLES
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttatgattttaaggtaaaagatgctcaaaagaatgaaatttcaatggattcc
tatagaggtaaggttcttcttattgttaatactgcaacaggctgcggatttacacctcaa
tatgaagctttggagaacctgtatagaacatataaggacaagggcttggaaattcttgat
tttccctgcaaccagtttttgaatcaggctcccggaactgaagaagaaatagttgagttt
tgtcagttgaaatatggagtttcttttaaaaccttttcgaagattgatgttaacggaagt
aatgcagacccattatatacatttttgaaaaaggcaaccccagctgataaggagaaccag
gaaacttcttcctttatgaaagttcttaaagatttaggccagagtattgtaggttcaaac
attaaatggaactttacaaagatcttaattgaccgtaatggtaacgttgtgggaagatat
tctccaacttataagcctgagaatatggaagcgaaaatacaggaacttttggagagctag

DBGET integrated database retrieval system