KEGG   Clostridium sp. BNL1100: Clo1100_0250Help
Entry
Clo1100_0250      CDS       T01708                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
clb  Clostridium sp. BNL1100
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:clb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:clb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265065..266390
Genome map
AA seq 441 aa AA seqDB search
MRKTRYRNRRRKFLTIFIVIFMAALTVVSGYAALLYSRDNHYNRGSDDKDMGVDTSYQTN
TATTSTSTPANTSGEPVQESDKLKEQIMSMSLDEKIGQMVIVGIDGYVADEHARQMIEEN
NVGGFILFKSNIQNSNQMLGLLNSLKSINRANKVPLFLSVDEEGGRVSRLPDEFLKIPSN
KTIGKLNNSSVSHQVGSIIGEELKSFGMNMDFAPVLDINSNPKNPVIGDRSFGTAPDLVS
KLGIQTMQGLQSQNIIPVVKHFPGHGDTSTDSHVGLPRVNNDLKRLRNFELRPFADAIEN
GAEAVMVAHILLPKIDPENPASFSRTIISDILRTEMNYDGVVITDDFTMGAIVKNYNIGQ
AAVKSILAGSDIVLVCHDYDKQKAVISALKNAAQSGQLPLDRIDQSVTRILRLKQEHEIT
DDPANAVDPKSINDKIRALLK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaaccagatataggaacagacgcagaaagtttttaacaatatttatagtaatt
tttatggcagccttaacagttgtgtcagggtatgcagctctgctttacagtcgtgataac
cactacaaccgtgggagcgacgataaagatatgggggtagatacctcttatcaaaccaat
actgcgacaacatctacatctacacccgctaatacttcaggggaacctgttcaagaaagt
gataaacttaaggaacagattatgagtatgagcctggatgaaaaaatcggtcagatggtg
atagttggtatagatggatatgtggcagatgaacatgcaaggcaaatgattgaagaaaat
aatgtgggaggatttatcctctttaaaagtaatatacagaattccaaccagatgcttgga
ttgttgaattcgttaaaaagtataaatcgggcaaacaaggtacctttatttctttcagta
gatgaagagggaggaagagtttccagactccccgacgaatttcttaaaattccttcaaat
aaaaccatcggtaaactcaataacagttctgtgtcacaccaagtgggcagtataattggt
gaagaacttaaatcctttggaatgaacatggattttgcacctgtccttgacattaacagc
aatccaaagaatccagttataggtgacagatctttcggaacagctccggatttggtgagt
aaacttggaattcagaccatgcagggcttgcagtcacaaaacattattcccgttgtaaag
cattttcccggtcatggtgatacgtcgacggattcacatgtgggacttccaagggttaat
aatgatttaaaaaggcttagaaactttgagttaagaccttttgctgatgcaatagaaaat
ggggcggaggcagtaatggtagcacatatactgttacccaaaatagatcctgaaaacccg
gcgtctttctccagaaccatcatttctgacatacttagaacagagatgaattatgatggg
gttgttattacagatgattttacaatgggggcaatagtaaagaactataatatcggtcag
gcggcagtaaagtctatacttgcgggaagtgatatagtcctagtgtgccatgattatgat
aaacagaaggcagtaatttctgctctgaaaaatgccgctcagtcgggacagttgcctttg
gaccggattgaccagagtgttacaaggatactgcggctaaagcaggaacacgaaattact
gatgatcctgcaaatgcagtagatcctaagtccataaatgacaaaatcagagctttgcta
aaatag

DBGET integrated database retrieval system