KEGG   Clostridium sp. BNL1100: Clo1100_0306Help
Entry
Clo1100_0306      CDS       T01708                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
clb  Clostridium sp. BNL1100
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1100_0306
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clo1100_0306
Enzymes [BR:clb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Clo1100_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334789..336051
Genome map
AA seq 420 aa AA seqDB search
MAKYVISEGVPLRGSVKVDGAKNAVLPIIAASLLSDSKSIIEEVPDLNDVRIMCDLLRCL
GADVQKQSDPTTISFETRKITNSTAPYELVNKLRASFLVMGPMLARTGYVRVALPGGCPI
GSRPVDLHLKGFAALGAEITQGHGYIEARKNKKLVGNKIYLDFPSVGATENIMMAAVMAE
GQTTIENAANEPEIVDLASYLNEMGANVVGAGTDTIRIEGVTSMKGCTHTVIPDRIEAGT
FMIAAAITNGEIRIENVVPDHLKPVVAKLKETGLEISEELSAITVKSTGELKPIDVKTLP
YPGFPTDMQAQMTSMLSCIPGTSMVIETIFENRFMHISELKRMGANIKIDGRTAVIEGKP
CLTGACVKATDLRAGAALVLAGLAAEGATEIGEIQHIDRGYSGFAEKLKSLGAKIERVDD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaatatgtaatcagtgaaggtgtgcctttgagaggcagtgtaaaagtagatggt
gcaaaaaatgcagttcttccaataatagcagcatccctgctaagcgattcaaaaagtata
atagaagaagttcccgacttgaatgatgtcaggataatgtgtgatttattaaggtgtctg
ggagcagatgttcaaaagcaatccgaccccacaactatatccttcgagaccaggaaaata
acaaattcaactgccccatatgaactggtaaacaagcttagagcgtctttcctagtaatg
ggcccgatgcttgccagaacaggctatgtgagggttgctttgccgggaggatgtcccata
gggtcaaggcctgttgatttacacttgaaaggcttcgccgctctaggtgcagagataact
caggggcacggttatattgaagccagaaaaaataaaaagctggtgggaaacaagatatat
ctggattttcccagtgttggtgcaactgaaaacattatgatggcagccgtaatggctgaa
ggccagacaactattgagaatgctgccaatgaacctgaaatagtggatctagcaagctat
ctaaatgaaatgggagcaaatgtagtaggagcaggcactgacaccataaggattgagggt
gttacaagcatgaagggctgtacccatacagtaattcccgaccgtattgaggcaggtaca
tttatgatagctgctgcaattaccaacggtgaaataagaattgaaaatgttgtacccgac
cacctgaaacctgtagttgcaaagctaaaagaaactggactggaaatttcggaggaattg
tccgcaataacggtaaaaagcacaggcgaactaaagccaatagatgtgaaaacactgccg
tatccgggctttcccactgatatgcaggctcagatgacatcaatgctttcctgtattcca
ggtacaagtatggttatagaaactatatttgagaacagatttatgcatataagtgagtta
aagagaatgggtgcaaatataaagatagatggaagaacagcagtaatagagggtaaaccg
tgccttacaggtgcatgtgtcaaagccacagacttaagagcaggtgcggcactggtactg
gcgggccttgcagcagagggagctactgaaataggtgaaatacagcatattgacagggga
tattcaggatttgcagaaaagctgaaatctcttggggcaaaaatagagcgggttgacgat
tag

DBGET integrated database retrieval system